DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp28d1 and Cyp9f2

Sequence 1:NP_608912.1 Gene:Cyp28d1 FlyBaseID:FBgn0031689 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_650189.1 Gene:Cyp9f2 FlyBaseID:FBgn0038037 Length:516 Species:Drosophila melanogaster

Alignment Length:528 Identity:145/529 (27%)
Similarity:251/529 (47%) Gaps:50/529 (9%)


  Fly     7 ALFVIAAILALIYVFLTWNFSYWKKRGIPTAKSWPFVGSFPSVFTQKRNVVYDIDEIYEQYKNTD 71
            |||.|||  ||.|.:.:.|..::|.|||...|...:.|:...:|.:||.:...:.::|.: ..:.
  Fly     7 ALFAIAA--ALFYRWASANNDFFKDRGIAYEKPVLYFGNMAGMFLRKRAMFDIVCDLYTK-GGSK 68

  Fly    72 SIVGVFQTRIPQLMVTTPEYAHKIYVSDFRSF--HDNEMAKFTDSKTDP-----ILANNPFVLTG 129
            ...|:|:.|.|.|||..|:...:|.:.||..|  |.|..|  |.|..||     :..::.|.:..
  Fly    69 KFFGIFEQRQPLLMVRDPDLIKQITIKDFDHFINHRNVFA--TSSDDDPHDMSNLFGSSLFSMRD 131

  Fly   130 EAWKERRAEVTPGLSANRVKAAYPVSLRVCKKFVEYIRRQSLMAPAQGLNAKDLCLCYTTEVISD 194
            ..||:.|:.::|..:.::::..:.:..:|.|:.|:.:::.........|:.||.|..:|.:||:.
  Fly   132 ARWKDMRSTLSPAFTGSKMRQMFQLMNQVAKEAVDCLKQDDSRVQENELDMKDYCTRFTNDVIAS 196

  Fly   195 CVLGISAQSFTDNPTPMVGMTKRV----FEQSFGFIFYTVVANLWPPITKFYSVSLFAKDVAAFF 255
            ...|:...||.|.......|.|::    |.||..|:.:..:..|    .|...|.||.:....:|
  Fly   197 TAFGLQVNSFKDRENTFYQMGKKLTTFTFLQSMKFMLFFALKGL----NKILKVELFDRKSTQYF 257

  Fly   256 YDLMQKCIQVRRESPAAQQRDDFLNYMLQLQ-----EKKGLNAA------ELTSHTMTFLTDGFE 309
            ..|:...::.|:|....  |.|.:|.:::.:     ||...:|.      ::.:....|...|||
  Fly   258 VRLVLDAMKYRQEHNIV--RPDMINMLMEARGIIQTEKTKASAVREWSDRDIVAQCFVFFFAGFE 320

  Fly   310 TTAQVLTHTLLFLARNPKEQMKLREEIGTA-------ELTFEQISELPFTEACIHETLRIFSPVL 367
            |:|.::..|...|..|...|.:|.||:...       |||:|.|..:.:.:..::|.||.:...:
  Fly   321 TSAVLMCFTAHELMENQDVQQRLYEEVQQVDQDLEGKELTYEAIMGMKYLDQVVNEVLRKWPAAI 385

  Fly   368 AARKVVTEPC--ELT-NKNGVSVKLRPGDVVIIPVNALHHDPQYYEEPQSFKPERFLNINGGAKK 429
            |    |...|  ::| :.:|..|:::.|||:.:|....|.||:|:|.|..|.||||.:.|   |:
  Fly   386 A----VDRECNKDITFDVDGQKVEVKKGDVIWLPTCGFHRDPKYFENPMKFDPERFSDEN---KE 443

  Fly   430 YRDQGLFFGFGDGPRICPGMRFSLTQIKAALVEIVRNFDIKVNPKTRKDNEIDDTYFMPALKGGV 494
            ......:|.||.|.|.|.|.||:|.:.||.:..:::::......|:....|:..:.|..:.|||.
  Fly   444 SIQPFTYFPFGLGQRNCIGSRFALLEAKAVIYYLLKDYRFAPAKKSCIPLELITSGFQLSPKGGF 508

  Fly   495 WLDFVERN 502
            |:..|:||
  Fly   509 WIKLVQRN 516

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp28d1NP_608912.1 p450 35..477 CDD:278495 122/474 (26%)
Cyp9f2NP_650189.1 p450 36..510 CDD:278495 128/490 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49377
eggNOG 1 0.900 E2759_KOG0158
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1576
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24292
RoundUp 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.