DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp28d1 and Cyp6d2

Sequence 1:NP_608912.1 Gene:Cyp28d1 FlyBaseID:FBgn0031689 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_611698.1 Gene:Cyp6d2 FlyBaseID:FBgn0034756 Length:512 Species:Drosophila melanogaster

Alignment Length:515 Identity:125/516 (24%)
Similarity:230/516 (45%) Gaps:62/516 (12%)


  Fly     6 TALFVIAAILALIYVFLTWNFSYWKKRGI--PTAKSWPFVGSFPSVFTQKRNVVYDIDEIYEQYK 68
            |.|..| .|..|:|.::..::::|::.|:  ..||. || |...:|..|:|::...:.:||.:::
  Fly     3 TILLTI-LIAGLLYRYVKRHYTHWQRLGVDEEPAKI-PF-GVMDTVMKQERSLGMALADIYARHE 64

  Fly    69 NTDSIVGVFQTRIPQLMVTTPEYAHKIYVSDFRSFHDNEMAKFTDSKTDPILANNPFVLTGEAWK 133
            .  .|||::......:::...:.|.:|..|||.||||..:  :.|...||:.| |.|.|.|.:|:
  Fly    65 G--KIVGIYMLNKRSILIRDAQLARQIMTSDFASFHDRGV--YVDEDKDPLSA-NLFNLRGASWR 124

  Fly   134 ERRAEVTPGLSANRVKAAYPVSLRVCKKFVEYIRRQSLMAPAQGLNAKDLCLCYTTEVISDCVLG 198
            ..|.::||..|:.::|..:.....|..|.|:::  :..:..:..:..||:...|..::|...:.|
  Fly   125 NLRQKLTPSFSSGKIKGMFGTIDDVGDKLVQHL--EGALDQSDEVEIKDVMTTYAVDIIGSVIFG 187

  Fly   199 ISAQSFTDNP----TPMVGMTKRVFEQSFGFIFYTVVANLWPPITKFYSVSLFAKDVAAFFYDLM 259
            :...||. ||    ..:...|.|  ::|.....:.:...:.|||.|..:...:...:.....|:|
  Fly   188 LEIDSFR-NPKNEFREISSSTSR--DESLLLKIHNMSMFICPPIAKLMNRLGYESRILTSLRDMM 249

  Fly   260 QKCIQVRRESPAAQQRDDFLNYMLQL--------------------QEKKGLNAAELTSHTMTFL 304
            ::.|:.|.|....  |.|.|..:::|                    ::.|.::..::.:....|.
  Fly   250 KRTIEFREEHNVV--RKDMLQLLIRLRNTGKIGEDDDQVWDMETAQEQLKSMSIEKIAAQAFLFY 312

  Fly   305 TDGFETTAQVLTHTLLFLARNPKEQMKLREEIGTA----------ELTFEQISELPFTEACIHET 359
            ..|.|:||.....||..|:..|:...:.:||:...          ..|:|.:.:|.|.:.||.||
  Fly   313 VAGSESTAAASAFTLYELSMYPELLKEAQEEVDAVLMKHNLKPKDRFTYEAVQDLKFLDICIMET 377

  Fly   360 LRIFSPVLAARKVVTEPCELTNKNGVSVKLRPGDVVIIPVNALHHDPQYYEEPQSFKPERF--LN 422
            :|.:..:....:..||...:...|.:..|   |..::|.:..:..||.|:..|..:.|.||  .|
  Fly   378 IRKYPGLPFLNRECTEDYPVPGTNHIIAK---GTPILISLFGMQRDPVYFPNPNGYDPHRFDSNN 439

  Fly   423 INGGAKKYRDQGLFFGFGDGPRICPGMRFSLTQIKAALVEIVRNFDIKVNPKTRKDNEID 482
            :|      .||..:..||:|||.|..:|......|.|:.:|:.|||:..:|:...:...|
  Fly   440 MN------YDQAAYMPFGEGPRHCIALRMGKVNSKVAVAKILANFDLVQSPRKEVEFRFD 493

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp28d1NP_608912.1 p450 35..477 CDD:278495 116/478 (24%)
Cyp6d2NP_611698.1 p450 65..506 CDD:278495 107/451 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50965
eggNOG 1 0.900 E2759_KOG0158
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I1453
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24292
RoundUp 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.