DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp28d1 and Cyp6w1

Sequence 1:NP_608912.1 Gene:Cyp28d1 FlyBaseID:FBgn0031689 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001286145.1 Gene:Cyp6w1 FlyBaseID:FBgn0033065 Length:514 Species:Drosophila melanogaster

Alignment Length:498 Identity:128/499 (26%)
Similarity:233/499 (47%) Gaps:42/499 (8%)


  Fly     8 LFVIAAILALIYVFLTWNFSYWKKRGIPTAKSWPFVGSFPSVFTQKRNVVYDIDEIYEQ--YKNT 70
            |.::.::..:.|::.....|:|::.|:...:.:|.||......|.|......|.:.:|.  ::| 
  Fly     4 LLLLGSLTIVFYIWQRRTLSFWERHGVKYIRPFPVVGCTREFLTAKVPFFEQIQKFHEAPGFEN- 67

  Fly    71 DSIVGVFQTRIPQLMVTTPEYAHKIYVSDFRSFHDNEMAKFTDSKTDPILANNPFVLTGEAWKER 135
            :..|||:.|..|.|::...|....:.:..|:.|::..:.  ||...|.:...|.|......|:|.
  Fly    68 EPFVGVYMTHRPALVIRDLELIKTVMIKKFQYFNNRVLQ--TDPHNDALGYKNLFFARSPGWREL 130

  Fly   136 RAEVTPGLSANRVKAAYPVSLRVCKKFVEYIRRQSLMAPAQGLNAKDLCLCYTTEVISDCVLGIS 200
            |.:::|..::.::|..||:.:::.|...:...|   :.....:..||||..:||::|:....|:.
  Fly   131 RTKISPVFTSGKIKQMYPLMVKIGKNLQDSAER---LGSGTEVQVKDLCSRFTTDLIATIAFGVE 192

  Fly   201 AQSFTDNPTPMVGMTKRVFEQS------FGFIFYTVVANLWPPITKFYSVSLFAKDVAAFFYDLM 259
            |.:..|..:......:.:|..:      |..||      :.|.:.....|.||:::...|....:
  Fly   193 ANALQDAKSEFFYHNRAIFSLTLSRGIDFAIIF------MIPALASLARVKLFSRETTKFIRSSV 251

  Fly   260 QKCIQVRRESPAAQQRDDFLNYMLQLQEKKGLNAAE---------LTSHTMTFLTDGFETTAQVL 315
            ...::.|..:  .::|:|.::.:|.|:.:...|..:         |.:....|.|.||||:|..:
  Fly   252 NYVLKERERT--GEKRNDLIDILLALKREAAANPGKMSKEVDLDYLVAQAAVFQTAGFETSASTM 314

  Fly   316 THTLLFLARNPKEQMKLREEI----GTAE-LTFEQISELPFTEACIHETLRIFSPVLAARKVVTE 375
            |.||..||:|...|.:||:||    |..: :::|:|.|:|:....::||||.:..|....:..::
  Fly   315 TMTLYELAKNEALQDRLRQEIVDFFGDEDHISYERIQEMPYLSQVVNETLRKYPIVGYIERECSQ 379

  Fly   376 PCE---LTNKNGVSVKLRPGDVVIIPVNALHHDPQYYEEPQSFKPERFLNINGGAKKYRDQGLFF 437
            |.|   .|.:...:::|..|..:.:...|:|.||||:.:|:.:.||||   |...:...:...:.
  Fly   380 PAEGERFTLEPFHNMELPHGMSIYMSTVAVHRDPQYWPDPEKYDPERF---NSSNRDNLNMDAYM 441

  Fly   438 GFGDGPRICPGMRFSLTQIKAALVEIVRNFDIKVNPKTRKDNE 480
            .||.|||.|.|||..|.|.|..||.|:||.......||.|..|
  Fly   442 PFGVGPRNCIGMRLGLLQSKLGLVHILRNHRFHTCDKTIKKIE 484

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp28d1NP_608912.1 p450 35..477 CDD:278495 121/467 (26%)
Cyp6w1NP_001286145.1 p450 34..501 CDD:278495 123/469 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50789
eggNOG 1 0.900 E2759_KOG0158
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1576
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24292
RoundUp 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.