DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp28d1 and Cyp3a2

Sequence 1:NP_608912.1 Gene:Cyp28d1 FlyBaseID:FBgn0031689 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_695224.2 Gene:Cyp3a2 RGDID:708379 Length:504 Species:Rattus norvegicus

Alignment Length:486 Identity:143/487 (29%)
Similarity:239/487 (49%) Gaps:45/487 (9%)


  Fly    10 VIAAILALIYVFLTWNFSYWKKRGIPTAKSWPFVGSFPSVFTQKRNVVYDIDEIYEQYKNTDSIV 74
            ::|.||.|:|...|.....:||:|||..|..||:|:..:.:  |....:|:    |.||....|.
  Rat    14 LLAVILVLLYRLGTHRHGIFKKQGIPGPKPLPFLGTVLNYY--KGLGRFDM----ECYKKYGKIW 72

  Fly    75 GVFQTRIPQLMVTTPEYAHKIYVSDFRSFHDNEMAKFTDSKTDPILANNPFVLTGEAWKERRAEV 139
            |:|..:.|...:...|....:.|.:..|...|.    .|.....|:.....|...|.||..||.:
  Rat    73 GLFDGQTPVFAIMDTEMIKNVLVKECFSVFTNR----RDFGPVGIMGKAVSVAKDEEWKRYRALL 133

  Fly   140 TPGLSANRVKAAYPVSLRVCKKFVEYIRRQSLMAPAQGLNAKDLCLCYTTEVISDCVLGISAQSF 204
            :|..::.|:|..:|:..:.....|:|:::::  ...:.:..|.:...|:.:||:....|::..|.
  Rat   134 SPTFTSGRLKEMFPIIEQYGDILVKYLKQEA--ETGKPVTMKKVFGAYSMDVITSTSFGVNVDSL 196

  Fly   205 TDNPTPMVGMTKRVFEQSFGF---IFYTVVANLWP---PITKFYSVSLFAKDVAAFFYDLMQKCI 263
            .:...|.|..||::..  |.|   :|.:||  |:|   ||.:..::.:|.||..|||...:.:..
  Rat   197 NNPKDPFVEKTKKLLR--FDFFDPLFLSVV--LFPFLTPIYEMLNICMFPKDSIAFFQKFVHRIK 257

  Fly   264 QVRRESPAAQQRDDFLNYMLQLQEK-------KGLNAAELTSHTMTFLTDGFETTAQVLTHTLLF 321
            :.|.:| ..:.|.|||..||.....       |.|:..|:.:.::.|:..|:|||:..|:..|.|
  Rat   258 ETRLDS-KHKHRVDFLQLMLNAHNNSKDEVSHKALSDVEIIAQSVIFIFAGYETTSSTLSFVLYF 321

  Fly   322 LARNPKEQMKLREEI-----GTAELTFEQISELPFTEACIHETLRIFSPVLAARKVVTEPCELTN 381
            ||.:|..|.||:|||     ..|..|::.:.|:.:.:..::||||::.......:|..:..||  
  Rat   322 LATHPDIQKKLQEEIDGALPSKAPPTYDIVMEMEYLDMVLNETLRLYPIGNRLERVCKKDIEL-- 384

  Fly   382 KNGVSVKLRPGDVVIIPVNALHHDPQYYEEPQSFKPERFLNIN-GGAKKYRDQGLFFGFGDGPRI 445
             :|:.:.  .|.||.||..|||||||::.:|:.|.||||...| |....|    ::..||:|||.
  Rat   385 -DGLFIP--KGSVVTIPTYALHHDPQHWPKPEEFHPERFSKENKGSIHPY----VYLPFGNGPRN 442

  Fly   446 CPGMRFSLTQIKAALVEIVRNFDIKVNPKTR 476
            |..|||:|..:|.||.::::||..:...:|:
  Rat   443 CIDMRFALMNMKLALTKVLQNFSFQPCKETQ 473

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp28d1NP_608912.1 p450 35..477 CDD:278495 133/462 (29%)
Cyp3a2NP_695224.2 p450 39..494 CDD:278495 133/462 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.909 Consistency score
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.