DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp28d1 and Tbxas1

Sequence 1:NP_608912.1 Gene:Cyp28d1 FlyBaseID:FBgn0031689 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_035669.3 Gene:Tbxas1 MGIID:98497 Length:533 Species:Mus musculus

Alignment Length:556 Identity:135/557 (24%)
Similarity:235/557 (42%) Gaps:106/557 (19%)


  Fly    10 VIAAILALIYVFLTWNFSYWKKRGIPTAKSWPFVGS---FPSVFTQKRNVVYDIDEIYEQYKNTD 71
            ::.|:|||:..:....||..:|.||...|..||||:   |...|.:.:.      |:.|:|   .
Mouse    20 LLVALLALLKWYSMSAFSRLEKLGIRHPKPSPFVGNLMFFRQGFWESQL------ELRERY---G 75

  Fly    72 SIVGVFQTRIPQLMVTTPEYAHKIYVSDFRSFHDNEMAKFTDSKTDPILANNPFVLTGEAWKERR 136
            .:.|.:..|...::::.|:...::.|.:|.:| .|.||...:.|   ::|::..:|....|:|.|
Mouse    76 PLCGYYLGRRMHVVISEPDMIKQVLVENFSNF-SNRMASGLEPK---MVADSVLLLRDRRWEEVR 136

  Fly   137 AEVTPGLSANRVKAAYPVSLRVCKKFVEYIRRQSLMAPAQGLNAKDLCLCYTTEVISDCVLGISA 201
            ..:....|..::....|:..:.|:..|.:::|.:  |.....|.:....|||.:|::....|...
Mouse   137 GALMSSFSPEKLDEMTPLISQACELLVAHLKRYA--ASRDAFNIQRCYCCYTIDVVASVAFGTQV 199

  Fly   202 QSFTDNPTPMVGMTKR-----------VFEQSFGFIFYTVVANLWPPITKFYSVSLFAKDVAAFF 255
            .|......|.|...:|           |...||..|. ..:|.:.|...:        .::..||
Mouse   200 DSQNSPEDPFVQHCRRASTFCIPRPLLVLILSFPSIM-VPLARILPNKNR--------DELNGFF 255

  Fly   256 YDLMQKCIQVRRESPAAQQRDDFLNYMLQLQE--------------------------------- 287
            ..|::..|.:|.:..|.::|.|||..:|..|.                                 
Mouse   256 NTLIRNVIALRDQQAAEERRRDFLQMVLDAQHSMNSVGVEGFDMVPESLSSSECTKEPPQRCHPT 320

  Fly   288 --KKGLNAAELTSHTMTFLTDGFETTAQVLTHTLLF----LARNPKEQMKLREEIGTAEL----- 341
              .|.....|:......||..|.|    |:|:||.|    ||.:|..|.:|.:|:   :|     
Mouse   321 STSKPFTVDEIVGQAFLFLIAGHE----VITNTLSFITYLLATHPDCQERLLKEV---DLFMGKH 378

  Fly   342 ---TFEQISE-LPFTEACIHETLRIFSPVLAARKVVTEPCELTNKNGVSVKLRPGDVVIIPVNAL 402
               .:..:.| ||:.:..|.||||::.|.....:...:.||:..:     ::..|.|:.|.|.||
Mouse   379 PAPEYHSLQEGLPYLDMVISETLRMYPPAFRFTREAAQDCEVLGQ-----RIPAGTVLEIAVGAL 438

  Fly   403 HHDPQYYEEPQSFKPERFLNINGGAKKYRDQGLFFGFGDGPRICPGMRFSLTQIKAALVEIVRNF 467
            ||||:::..|::|.||||   ...|:..|....:..||.|||.|.|:|..|..:|..:::::..|
Mouse   439 HHDPEHWPNPETFDPERF---TAEARLQRRPFTYLPFGAGPRSCLGVRLGLLVVKLTILQVLHKF 500

  Fly   468 DIKVNPKTRKDNEIDDTYFMPAL--KGGVWLDFVER 501
            ..:.:|:|:...:::.   ..||  |.||::..|.|
Mouse   501 RFEASPETQVPLQLES---KSALGPKNGVYIKIVSR 533

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp28d1NP_608912.1 p450 35..477 CDD:278495 119/504 (24%)
Tbxas1NP_035669.3 p450 47..530 CDD:278495 124/525 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.703 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.780

Return to query results.
Submit another query.