DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp28d1 and cyp-13A11

Sequence 1:NP_608912.1 Gene:Cyp28d1 FlyBaseID:FBgn0031689 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_499704.1 Gene:cyp-13A11 WormBaseID:WBGene00008809 Length:517 Species:Caenorhabditis elegans

Alignment Length:541 Identity:134/542 (25%)
Similarity:241/542 (44%) Gaps:76/542 (14%)


  Fly     8 LFVIAAILALI-YVFLTWNFSYWKKRGIPTAKSWPFVGSFPSVFTQKRNVVYDIDEIYEQYKNTD 71
            |||:::::.:: |.|.||  :||::.|||..:.:||:||...:...:......:.:...||   .
 Worm     5 LFVVSSVVGIVSYYFWTW--TYWRRCGIPGPQGYPFLGSALDMMDHENPPFLQLKKWTSQY---G 64

  Fly    72 SIVGVFQTRIPQLMVTTPEYAHKIYVSDFRSFHDNEMAKFTDSKTDPILANNP--------FVLT 128
            .:.|:.:..:..|:::.....|:::|..:.:|:...:        :|| ..:|        |...
 Worm    65 KVYGITEGLLRTLVISDTNLIHEVFVKQYDNFYGRNL--------NPI-QGDPNREKRVTLFSAQ 120

  Fly   129 GEAWKERRAEVTPGLSANRVKAAYPVSLRVCKKFVEYIRR-QSLMAPAQGLNAKDLCLCYTTEVI 192
            |..||..|....|..|:|.::   .:.:.|....:|.:|. :...|..:.::..:....:|.:||
 Worm   121 GHRWKRLRTIANPTFSSNNLR---KIQVTVEDSALELLRHIEQHTAGGKAIDVLEYFQEFTMDVI 182

  Fly   193 SDCVLGISAQSFTDNPTPMVGMTKRVFEQSFGFIFYTVVANLW--PPITK--FYSVSLFAKDVAA 253
            ....:|........|  |::...:.||.:....:|.:.:...|  |.|.|  ||..::|....|.
 Worm   183 GRIAMGQPDSLMFKN--PLLPCARDVFGKPRTALFLSGILFPWIGPMIRKVVFYFTNVFNNPAAQ 245

  Fly   254 FFYDLMQKCIQVRRESPAAQQR--------DDFLNYMLQLQE------------KKG------LN 292
            ..|. ....::.|.:...|:::        .||::..|..:.            |.|      |.
 Worm   246 IMYQ-TANAVEQRIKQRMAEEKAGIDPGEPQDFIDLFLDAKSDDMELENNEDFTKAGVKVTRQLT 309

  Fly   293 AAELTSHTMTFLTDGFETTAQVLTHTLLFLARNPKEQMKLREEI----GTAELTFEQISELPFTE 353
            ..|:......||..||:|||..|:::...||.:||.|.||:|||    ...|:||:|:|:|.:.|
 Worm   310 KDEVVGQCFVFLIAGFDTTALSLSYSSFLLATHPKAQKKLQEEIDRECADPEVTFDQLSKLKYME 374

  Fly   354 ACIHETLRIFSPVLAARKVVTEPCELTNKNGVSVKLRPGDVVIIPVNALHHDPQYY-EEPQSFKP 417
            ..|.||||:: |:.|...  :..|..:.|.| :.::..|..::.....||:|...: |:.:.|||
 Worm   375 CVIKETLRMY-PLGALAN--SRRCMRSTKIG-NYEIEKGVDILCDTWTLHYDKSIWGEDAEEFKP 435

  Fly   418 ERFLNINGGAKKYRDQGLFFGFGDGPRICPGMRFSLTQIKAALVEIVRNFDIKVNPKTRKDNE-I 481
            ||:   ..|.:.:..:|.:..||.|||.|.|||.:..:.|..|..|:|.:.::|..||:...: |
 Worm   436 ERW---ESGDEHFYQKGGYIPFGLGPRQCIGMRLAYMEEKLLLSHILRKYTLEVCNKTQIPLKLI 497

  Fly   482 DDTYFMPALKGGVWLDFVERN 502
            ......|.   .|||:...|:
 Worm   498 GSRTTQPE---SVWLNLTPRD 515

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp28d1NP_608912.1 p450 35..477 CDD:278495 117/486 (24%)
cyp-13A11NP_499704.1 p450 31..506 CDD:278495 119/503 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.734 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.