DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp28d1 and cyp-25A1

Sequence 1:NP_608912.1 Gene:Cyp28d1 FlyBaseID:FBgn0031689 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_497775.3 Gene:cyp-25A1 WormBaseID:WBGene00007963 Length:502 Species:Caenorhabditis elegans

Alignment Length:511 Identity:110/512 (21%)
Similarity:216/512 (42%) Gaps:88/512 (17%)


  Fly     7 ALFVIAAILALIYVFLTW-------NFSYWKKRGIPTAKSWPFVGSFPSVFTQKRNVVYD----- 59
            ||.::::::..|:.|..:       .|...:|.|:...:...|:|:......:|..:.||     
 Worm     2 ALLILSSLVISIFTFFIYIILARRERFKLREKIGLSGPEPHWFLGNLKQTAERKEKLGYDDANRW 66

  Fly    60 IDEIYEQYKNTDSIVGVFQTRIPQLMVTTPEYAHKIYVSDFRSFHDNEMAKFTDSK--TDPILAN 122
            .:|::|||..|   .|::......::::..:...::::.:|.:|.|..:....::.  |..:|.|
 Worm    67 FNELHEQYGET---FGIYYGSQMNIVISNEKDIKEVFIKNFSNFSDRSVPSIYEANQLTASLLMN 128

  Fly   123 NPFVLTGEAWKERRAEVTPGLSANRVKAAYPVSLRVCKKFVEYIRRQS-------LMAPAQGLNA 180
            :    ....||..|:.:.|..|..::||...........|::.:|.::       :....|||  
 Worm   129 S----YSSGWKHTRSAIAPIFSTGKMKAMQETINSKVDLFLDILREKASSGQKWDIYDDFQGL-- 187

  Fly   181 KDLCLCYTTEVISDCVLGISAQSFTDNPTPMVGMTKRVFEQSFGFIFYT----VVANLWPPITKF 241
                   |.:||..|...|.:....|.                ..:||.    .::|:....:|.
 Worm   188 -------TLDVIGKCAFAIDSNCQRDR----------------NDVFYVNAKKYISNIDIRHSKI 229

  Fly   242 YSVSLFAKDVAAFFYDLMQ---------------KCIQVRRESPAAQQRDDFLNYMLQLQEKKG- 290
            .:.|:...:::.|:..|.:               ..:..||.........|.|..:|..::.|. 
 Worm   230 IAASVLLPELSTFWKALYKYTPLADAEIPLVEGLSNVYERRRGGEGSDSVDLLKLLLNREDDKSK 294

  Fly   291 -LNAAELTSHTMTFLTDGFETTAQVLTHTLLFLARNPKEQMKLREEIGTAE----LTFEQISELP 350
             :...|:..:...||..|:|||:..:|:....|::.|..|.||.|||..|:    ||::.|..:.
 Worm   295 PMTKQEVIENCFAFLLAGYETTSTAMTYCSYLLSKYPNVQQKLYEEIMEAKENGGLTYDSIHNMK 359

  Fly   351 FTEACIHETLRIFSPVL-AARKVVTEPCELTNKNGVSVKLRPGDVVIIPVNALHHDPQYYEEPQS 414
            :.:....||||.:.||: ..|::..|  ::|.:.....|   |.:|:...:.:|.:|:.::.|:.
 Worm   360 YLDCVYKETLRFYPPVIHFIRRLCRE--DITIRGQFYPK---GAIVVCLPHTVHRNPENWDSPEE 419

  Fly   415 FKPERFLNINGGAKKYRDQGLFFGFGDGPRICPGMRFSLTQIKAALVEIVRNFDIK 470
            |.||||.|....:...:    :..||.|||.|.||||:..:.|..:|:::..|::|
 Worm   420 FHPERFENWEEKSSSLK----WIPFGVGPRYCVGMRFAEMEFKTTIVKLLDTFELK 471

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp28d1NP_608912.1 p450 35..477 CDD:278495 103/477 (22%)
cyp-25A1NP_497775.3 p450 37..496 CDD:278495 103/477 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24292
Phylome 1 0.910 0.836 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.880

Return to query results.
Submit another query.