DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp28d2 and Cyp6a8

Sequence 1:NP_608911.1 Gene:Cyp28d2 FlyBaseID:FBgn0031688 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_523749.2 Gene:Cyp6a8 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster

Alignment Length:530 Identity:146/531 (27%)
Similarity:243/531 (46%) Gaps:76/531 (14%)


  Fly     7 FLVLVLTLLVLVYVFLTWNFNYWRKRGIKTAPTWPFV------GSFPSIFTRKRNIAYDIDDIYE 65
            |.|.|..|.:|.| ::.....|:::|||      |||      |:...: .:.:||.....|.|.
  Fly     8 FQVAVALLAILTY-YIHRKLTYFKRRGI------PFVAPHLIRGNMEEL-QKTKNIHEIFQDHYN 64

  Fly    66 KYKDTD-NMVGVFTTRVPQLLVMCPEYIHKIYATDFRSFHNNEWRNFVNKKTDMILGNNPFVLTG 129
            |::::. ..||.|..:.|...|:..|...:|...||.:|.|.  ..|.|:|.|.| ..:.|.|.|
  Fly    65 KFRESKAPFVGFFFFQSPAAFVIDLELAKQILIKDFSNFSNK--GIFYNEKDDPI-SAHLFNLDG 126

  Fly   130 DEWKERRSEIMPALSPNRVKAVYPVSQSVCKKFVEYIRRQQQMATSEGLDAMDLSLCYTTEVVSD 194
            .:|:..|:::....:..::|.:||...||..:|:..:  .:::..:..|:..||...:|.:|:..
  Fly   127 AQWRLLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVM--HEKVPKNSVLEIRDLVARFTVDVIGT 189

  Fly   195 CGLGVSAQSFTDTPTPLLKMIKR---------VFNTSFEFIFYSVVTNLWQKVRKFYSVPFFNKE 250
            |..|:...|..|.....|...||         :.|.     |......|.:|:....:.|...: 
  Fly   190 CAFGIQCNSLRDEKAEFLYFGKRSLVDKRHGTLLNG-----FMRSYPKLARKLGMVRTAPHIQE- 248

  Fly   251 TEVFFLDIIRRCITLRLEKPEQQRDDFLNYMLQLQEKK-----------GLHTDNILINTMTFIL 304
               |:..|:...:.:| ||...:|:||::.:::|:.:|           ||..:.:|.....|.:
  Fly   249 ---FYSRIVTETVAVR-EKEHIKRNDFMDMLIELKNQKEMTLENGDVVRGLTMEEVLAQAFVFFI 309

  Fly   305 DGFETTALVLAHIMLMLGRNPEEQDKVRKEIGSA------DLTFDQMSELPHLDACIYETLRLFS 363
            .||||::..:...:..|.:||:.|||||.|:...      :.|::...:|.:|:..:.|||||::
  Fly   310 AGFETSSSTMGFALYELAKNPDIQDKVRAEVEEVIEQHDQNFTYECTKDLKYLNQVLDETLRLYT 374

  Fly   364 -----PQVAARKLVT--EPFEFANKNGRTVHLKPGDVVTIPVKALHHDPQYYEDPLTFKPERFLE 421
                 .::||::.|.  .| .|.        ::.|..|.||..|:||||..|.:|..|:||||..
  Fly   375 IVPNLDRMAAKRYVVPGHP-NFV--------IEAGQSVIIPSSAIHHDPSIYPEPFEFRPERFSP 430

  Fly   422 SNGGGMKSYRDRGVYLAFGDGPRHCPGMRFALTQLKAALVEILRNFEIKVNPKTRSDNQIDDTFF 486
            ....|..|.    .:|.||||||:|.|:||...|.:..|..::|||:.....||.:....|...|
  Fly   431 EESAGRPSV----AWLPFGDGPRNCIGLRFGQMQARIGLALLIRNFKFSTCSKTPNPLVYDPKSF 491

  Fly   487 MATLKGGIYL 496
            :..:|.||||
  Fly   492 VLGVKDGIYL 501

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp28d2NP_608911.1 p450 38..475 CDD:299894 128/477 (27%)
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 133/493 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50651
eggNOG 1 0.900 E2759_KOG0158
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1576
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24292
RoundUp 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.