DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14036 and CG34283

Sequence 1:NP_608903.1 Gene:CG14036 FlyBaseID:FBgn0031677 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_001097831.1 Gene:CG34283 FlyBaseID:FBgn0085312 Length:153 Species:Drosophila melanogaster

Alignment Length:96 Identity:31/97 (32%)
Similarity:49/97 (51%) Gaps:8/97 (8%)


  Fly     5 EYGICPYDKSHRILLFRMPKHLIKCEKNYCGPPLQTCKYNA--THRVQDMEKHLKECD---YYLR 64
            |:.:||:|..||||...|..|:::|.||:....|..|.||.  .|.|.:||.|:.:|.   |..|
  Fly    15 EHLVCPFDGLHRILPLDMKTHVLQCAKNFPLEKLVHCPYNCGQIHSVAEMENHINDCPDRAYLER 79

  Fly    65 S--IENQAVQIALRSR-IPPKQEDGHDVDTP 92
            :  ..::...:|.|.| :..:.|:..|.:.|
  Fly    80 NNVPSDELPSLAQRPRGVEVESEEDWDAEPP 110

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14036NP_608903.1 zf-U11-48K 8..30 CDD:283028 10/22 (45%)
zf-U11-48K 40..59 CDD:283028 8/21 (38%)
CG34283NP_001097831.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4376
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1359124at2759
OrthoFinder 1 1.000 FOG0001149
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21402
RoundUp 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.