DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9121 and AKR2

DIOPT Version :8

Sequence 1:NP_608901.1 Gene:CG9121 / 33732 FlyBaseID:FBgn0031675 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_001190925.1 Gene:AKR2 / 829697 AraportID:AT4G35450 Length:350 Species:Arabidopsis thaliana

Alignment Length:344 Identity:77/345 (22%)
Similarity:127/345 (37%) Gaps:81/345 (23%)


  Fly    47 AAILGDAELLELLLQSCEEPELNVFHQS---------------NTDSLEIERTPEGMEKLEWVDE 96
            |:||.|..:.|:..|..::|..|...:.               |.|..:...|   |:::....|
plant    53 ASILNDPSIREMAEQIAKDPAFNQLAEQLQRSIPNAGQEGGFPNFDPQQYVNT---MQQVMHNPE 114

  Fly    97 FENSAENGAGSGEEDSQLYQYY-AKTFETTGEFISSQCCVSCREHDPHLY----DADVATP---- 152
            |:..||....:..:|.|:..:. |.:...|.|..:.:  ::..:.||.|.    :.|...|    
plant   115 FKTMAEKLGTALVQDPQMSPFLDAFSNPETAEHFTER--MARMKEDPELKPILDEIDAGGPSAMM 177

  Fly   153 ----LHYAAYWGHEECVRILLEHNAPINVLNNDGYAPLHLGAGFAGVTELLIKHGALVNAKTLSD 213
                |....||...|             ||...|.|   :|...||:.:..:.....| |:...:
plant   178 KKNYLFCFRYWNDPE-------------VLKKLGEA---MGMPVAGLPDQTVSAEPEV-AEEGEE 225

  Fly   214 GKTALHMAIESKCAESARLLLQTNININDTDDDGETPLMAAIACSMLDVAEELVKRGARINIQDK 278
            .::.:|........|..:..|.:..|.::.|.:|.|.|..|.....|..|:.|:..||.:|..||
plant   226 EESIVHQTASLGDVEGLKAALASGGNKDEEDSEGRTALHFACGYGELKCAQVLIDAGASVNAVDK 290

  Fly   279 QNHTALQYAV-RGRHTQMAKLLLERGARRLASQHLLHLAVESNVKELVELLLQYGESLSVWNLKN 342
            ..:|.|.||. .||                              ||.|.|||:.|.::::.||..
plant   291 NKNTPLHYAAGYGR------------------------------KECVSLLLENGAAVTLQNLDE 325

  Fly   343 FTPIMLAIHRGRHEMLEYL 361
            .|||.:|....:.|:::.|
plant   326 KTPIDVAKLNSQLEVVKLL 344

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9121NP_608901.1 ANK 151..300 CDD:238125 37/158 (23%)
ANK repeat 151..179 CDD:293786 7/36 (19%)
Ank_2 153..244 CDD:289560 17/91 (19%)
ANK repeat 181..210 CDD:293786 7/29 (24%)
ANK repeat 213..244 CDD:293786 4/31 (13%)
Ank_2 218..304 CDD:289560 23/87 (26%)
ANK 241..362 CDD:238125 34/123 (28%)
ANK repeat 246..277 CDD:293786 10/31 (32%)
ANK repeat 279..304 CDD:293786 6/26 (23%)
Ank_4 311..362 CDD:290365 15/52 (29%)
SOCS_box 518..574 CDD:284857
AKR2NP_001190925.1 ANK 231..344 CDD:238125 37/143 (26%)
Ank_2 231..322 CDD:289560 30/121 (25%)
ANK repeat 258..289 CDD:293786 10/31 (32%)
ANK repeat 291..322 CDD:293786 13/61 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
10.910

Return to query results.
Submit another query.