DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9121 and 4930430A15Rik

DIOPT Version :8

Sequence 1:NP_608901.1 Gene:CG9121 / 33732 FlyBaseID:FBgn0031675 Length:600 Species:Drosophila melanogaster
Sequence 2:XP_006500145.1 Gene:4930430A15Rik / 67575 MGIID:1914825 Length:514 Species:Mus musculus

Alignment Length:215 Identity:69/216 (32%)
Similarity:101/216 (47%) Gaps:17/216 (8%)


  Fly   132 QCCVSCREHDPHLYDADVATPLHYAAYWGHEECVRILLEHNAPINVLNNDGYAPLHLGAGFAGVT 196
            |..:|..:|..|..|....|.||:|...|..|.|.|||.:|..|:..:.:...||     ...|.
Mouse    62 QRMISLGKHSVHDRDFKERTALHFACACGQVEVVSILLRNNCDIDAADMNFITPL-----MKAVQ 121

  Fly   197 E-------LLIKHGALVNAKTLSDGKTALHMAIESKCAESARLLLQTNININDTDDDGETPLMAA 254
            .       :|:||||..|.|. .:|.|:||.|:.......|:.||:.:.|:...:.||.|||:.|
Mouse   122 NWTYECVCILLKHGADPNRKD-KNGNTSLHYAVSEDNQTLAKCLLKYSANMEQKNKDGFTPLLLA 185

  Fly   255 IACSMLDVAEELVKRGARINIQDKQNHTALQYAVRGRHTQMAKLLLERGA----RRLASQHLLHL 315
            :..:.:::|:.|||.||.|::.|......|.||:|.....|..|||:.|.    |.:.....|..
Mouse   186 LKENKIEMAKFLVKMGANIHVFDDMRRNTLLYAIRWDSKDMVNLLLDEGIDFFFRDVFGWTALRY 250

  Fly   316 AVESNVKELVELLLQYGESL 335
            |:|...|...|:|:.|.|.|
Mouse   251 AIEGTSKGSREILMNYDEML 270

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9121NP_608901.1 ANK 151..300 CDD:238125 52/156 (33%)
ANK repeat 151..179 CDD:293786 12/28 (43%)
Ank_2 153..244 CDD:289560 30/98 (31%)
ANK repeat 181..210 CDD:293786 10/36 (28%)
ANK repeat 213..244 CDD:293786 9/31 (29%)
Ank_2 218..304 CDD:289560 30/86 (35%)
ANK 241..362 CDD:238125 33/100 (33%)
ANK repeat 246..277 CDD:293786 13/31 (42%)
ANK repeat 279..304 CDD:293786 9/25 (36%)
Ank_4 311..362 CDD:290365 9/26 (35%)
SOCS_box 518..574 CDD:284857
4930430A15RikXP_006500145.1 Ank_4 49..99 CDD:290365 14/37 (38%)
ANK repeat 49..76 CDD:293786 4/14 (29%)
ANK 75..198 CDD:238125 40/129 (31%)
ANK repeat 80..109 CDD:293786 12/29 (41%)
Ank_2 83..175 CDD:289560 30/98 (31%)
ANK repeat 114..142 CDD:293786 10/33 (30%)
ANK 139..263 CDD:238125 40/125 (32%)
ANK repeat 144..175 CDD:293786 9/31 (29%)
Ank_2 149..241 CDD:289560 31/92 (34%)
ANK repeat 177..208 CDD:293786 13/31 (42%)
ANK repeat 210..235 CDD:293786 9/25 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000728
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.