DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9121 and ASB4

DIOPT Version :8

Sequence 1:NP_608901.1 Gene:CG9121 / 33732 FlyBaseID:FBgn0031675 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_057200.1 Gene:ASB4 / 51666 HGNCID:16009 Length:426 Species:Homo sapiens

Alignment Length:433 Identity:103/434 (24%)
Similarity:170/434 (39%) Gaps:100/434 (23%)


  Fly   150 ATPLHYAAYWGHEECVRILLEHNAPINVLNNDGYAPLHLGAGFAGV--TELLIKHGALVNAKTLS 212
            ||.||.:..:||.||:.:||:|||.||...| |..|||:....|.|  .::|...||.:|..:||
Human    76 ATGLHLSVLFGHVECLLVLLDHNATINCRPN-GKTPLHVACEMANVDCVKILCDRGAKLNCYSLS 139

  Fly   213 DGKTALHMAIESKCAESARLLL--QTNININDTDDDGETPLMAAIACSMLDVAEELVKRGARINI 275
             |.||||..........|:.|:  ..|:|:...:.|.||||..|....:.::....|:.||.::.
Human   140 -GHTALHFCTTPSSILCAKQLVWRGANVNMKTNNQDEETPLHTAAHFGLSELVAFYVEHGAIVDS 203

  Fly   276 QDKQNHTALQYAVRGRHTQMAKLLLERGARRLASQHLLHLAVESNVKELVELLLQYGESLSVWNL 340
            .:....|.|..|        |...|....:..:::|  ||        :..:||.|...::..:.
Human   204 VNAHMETPLAIA--------AYWALRFKEQEYSTEH--HL--------VCRMLLDYKAEVNARDD 250

  Fly   341 KNFTPIMLAIHRGRHEMLEYLLNVAEEQRKLGLYSDVHDEGLVLFAVQQNFWVKEFSRILRVLLA 405
            ...:|:..|.....|.::..:|....|...:    |::....:.:             :|:|...
Human   251 DFKSPLHKAAWNCDHVLMHMMLEAGAEANLM----DINGCAAIQY-------------VLKVTSV 298

  Fly   406 KSPSARNDFYDSCAPTIVCGLIYCHTPLSRAINLHRLEVAEF-LIHEGCNLAQICREHVVNELRS 469
            : |:|:        |.|...|:..|       ...|:...:| .:.:.|:......|.|||    
Human   299 R-PAAQ--------PEICYQLLLNH-------GAARIYPPQFHKVIQACHSCPKAIEVVVN---- 343

  Fly   470 NCTPTRLAFARLLCNAGFQFPHKHRPLPKDWPPARLEFEREM---CLLGTQPRSLQSLARLEIRR 531
                   |:..:..|..::     |.:|.|......:|...:   |.  ..||:|..|:|..|||
Human   344 -------AYEHIRWNTKWR-----RAIPDDDLEKYWDFYHSLFTVCC--NSPRTLMHLSRCAIRR 394

  Fly   532 SL-LRCLQTRPEVQERYLPTQERSSLGRIVDEFAIPATLKRYL 573
            :| .||        .|.:|.            .::|.:||:||
Human   395 TLHNRC--------HRAIPL------------LSLPLSLKKYL 417

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9121NP_608901.1 ANK 151..300 CDD:238125 49/153 (32%)
ANK repeat 151..179 CDD:293786 14/28 (50%)
Ank_2 153..244 CDD:289560 35/95 (37%)
ANK repeat 181..210 CDD:293786 10/31 (32%)
ANK repeat 213..244 CDD:293786 9/33 (27%)
Ank_2 218..304 CDD:289560 20/88 (23%)
ANK 241..362 CDD:238125 23/121 (19%)
ANK repeat 246..277 CDD:293786 9/31 (29%)
ANK repeat 279..304 CDD:293786 5/25 (20%)
Ank_4 311..362 CDD:290365 9/51 (18%)
SOCS_box 518..574 CDD:284857 18/58 (31%)
ASB4NP_057200.1 ANK 1 74..103 15/27 (56%)
ANK 77..191 CDD:238125 42/116 (36%)
ANK repeat 77..104 CDD:293786 14/27 (52%)
ANK repeat 106..137 CDD:293786 11/32 (34%)
ANK 2 106..135 11/30 (37%)
ANK repeat 139..169 CDD:293786 10/31 (32%)
ANK 3 139..168 10/30 (33%)
ANK 172..294 CDD:238125 27/157 (17%)
ANK repeat 172..205 CDD:293786 9/33 (27%)
ANK 4 174..203 9/29 (31%)
ANK repeat 207..249 CDD:293786 11/60 (18%)
ANK 5 207..247 11/58 (19%)
Essential for interaction with HIF1AN. {ECO:0000250} 238..239 1/1 (100%)
Essential for interaction with HIF1AN. {ECO:0000250} 244..246 0/2 (0%)
ANK repeat 251..282 CDD:293786 5/35 (14%)
ANK 6 251..280 5/29 (17%)
SOCS_ASB4_ASB18 379..426 CDD:239693 18/60 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I4872
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.