DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9121 and Asb10

DIOPT Version :8

Sequence 1:NP_608901.1 Gene:CG9121 / 33732 FlyBaseID:FBgn0031675 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_001102686.1 Gene:Asb10 / 499972 RGDID:1562922 Length:465 Species:Rattus norvegicus

Alignment Length:488 Identity:118/489 (24%)
Similarity:161/489 (33%) Gaps:187/489 (38%)


  Fly   145 YDADVATPLHYAAYWGHEE--------------------------------CVRILLEHNAPINV 177
            ::.::.||||.||..||.|                                ||.:||...|..|.
  Rat   110 FEEELTTPLHVAASRGHTEVLQLLLRRRAKPDSAPGGRTALHEACAAGHAACVHVLLVAGADPNT 174

  Fly   178 LNNDGYAPLHL--GAGFAGVTELLIKHGALVNAKTLSDGKTALHMAIESKCAESARLLLQTNINI 240
            .:.||..||||  |.|.....|||:|.||.|:.::..:.:|.||:|......|.|.|||:.....
  Rat   175 PDQDGKRPLHLCRGPGILECVELLLKFGAQVDGRSEDEEETPLHVAARLGHVELADLLLRWGACP 239

  Fly   241 NDTDDDGETPLMAA--IACSMLDVAEELVKRGARINIQDKQNHTALQYAVRGRHTQMAKLLLERG 303
            :..:.:|.|||:.|  ..|.....||                      |...|..|:..|||..|
  Rat   240 HVRNSEGWTPLLTACDARCQSPVDAE----------------------ATANRCFQLCSLLLSVG 282

  Fly   304 ARRLAS----QHLLHLAVESNVKELVELLLQYGESLSVWNLKNFTPIMLAI--------HRGRHE 356
            |...|:    |..||||.......:|:|||..|.|.:..:....||:..|:        |...| 
  Rat   283 ADADAANQDKQRPLHLACRHGHSAVVQLLLSCGVSANAMDYGGHTPLHCALLGPTTALAHSPEH- 346

  Fly   357 MLEYLLNVAEEQRKLGLYSDVHDEGLVLFAVQQNFWVKEFSRILRVLLAKSPSARNDFYDSCAPT 421
            ::..|||          |..|            ..|               |.|.....|.    
  Rat   347 IVRDLLN----------YGAV------------RVW---------------PGALPKVLDR---- 370

  Fly   422 IVCGLIYCHTPLSRAINLHRLEVAEFLIHEGCNLAQICREHVVNELRSNCTPTRLAFARLLCNAG 486
                  :|.:|  |.|                       |.::|..|.                 
  Rat   371 ------WCMSP--RTI-----------------------EVLMNTYRV----------------- 387

  Fly   487 FQFPHKHRPLPKDWPPARLE----FEREMCLLGTQPRSLQSLARLEIRRSLLRCLQTRPEVQERY 547
            .|.|.:.:.|.   ||..|:    |...:..|..||||||.|.|..:|..|           |..
  Rat   388 VQLPEEAKGLV---PPEILQKHCGFYSSLFALVKQPRSLQHLCRWALRTHL-----------EGR 438

  Fly   548 LPTQERSSLGRIVDEFAIPATLKRYLS-DFDEL 579
            ||    .:|.|:    .:|..:.|||. ||::|
  Rat   439 LP----HALPRL----PLPPRMLRYLQLDFEDL 463

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9121NP_608901.1 ANK 151..300 CDD:238125 52/185 (28%)
ANK repeat 151..179 CDD:293786 15/60 (25%)
Ank_2 153..244 CDD:289560 37/125 (30%)
ANK repeat 181..210 CDD:293786 15/31 (48%)
ANK repeat 213..244 CDD:293786 9/31 (29%)
Ank_2 218..304 CDD:289560 23/88 (26%)
ANK 241..362 CDD:238125 34/135 (25%)
ANK repeat 246..277 CDD:293786 8/33 (24%)
ANK repeat 279..304 CDD:293786 7/25 (28%)
Ank_4 311..362 CDD:290365 16/59 (27%)
SOCS_box 518..574 CDD:284857 18/56 (32%)
Asb10NP_001102686.1 Ank_4 115..166 CDD:290365 12/51 (24%)
ANK repeat 116..143 CDD:293786 9/27 (33%)
ANK 116..141 CDD:197603 9/25 (36%)
ANK 146..312 CDD:238125 55/188 (29%)
ANK repeat 146..176 CDD:293786 6/30 (20%)
Ank_2 150..243 CDD:289560 30/93 (32%)
ANK repeat 178..210 CDD:293786 15/32 (47%)
ANK repeat 212..243 CDD:293786 9/31 (29%)
Ank_2 217..322 CDD:289560 36/127 (28%)
ANK repeat 245..289 CDD:293786 17/66 (26%)
ANK 286..>356 CDD:238125 21/81 (26%)
ANK repeat 291..322 CDD:293786 11/31 (35%)
Ank_2 296..>356 CDD:289560 19/71 (27%)
SOCS 419..458 CDD:239641 19/58 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I5079
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.