DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9121 and POTEG

DIOPT Version :8

Sequence 1:NP_608901.1 Gene:CG9121 / 33732 FlyBaseID:FBgn0031675 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_001005356.1 Gene:POTEG / 404785 HGNCID:33896 Length:508 Species:Homo sapiens

Alignment Length:363 Identity:78/364 (21%)
Similarity:134/364 (37%) Gaps:109/364 (30%)


  Fly    41 RTAVGTAAILGDAELLELLL-QSCEEPELNVFHQSNTDSLEIERTPEGMEKLEWVDEFENSAENG 104
            |||:..|:..|::|:::||| :.|   :||:                       :|..:.:|...
Human   174 RTALHLASANGNSEVVKLLLDRRC---QLNI-----------------------LDNKKRTALTK 212

  Fly   105 AGSGEEDSQLYQYYAKTFETTGEFISSQCCVSCREH--DPHLYDADVATPLHYAAYWGHEECVRI 167
            |....||                    :|.:...||  ||::.|....|.||||.|...:...:.
Human   213 AVQCRED--------------------ECALMLLEHGTDPNIPDEYGNTALHYAIYNEDKLMAKA 257

  Fly   168 LLEHNAPINVLNNDGYAPLHLGAGFAGVTELLIKHGALVNAKTLSDGKTALHMAIESKCAESARL 232
            ||.:.|.|...|..|..||.||                                :..:..:..:.
Human   258 LLLYGADIESKNKHGLTPLLLG--------------------------------VHEQKQQVVKF 290

  Fly   233 LLQTNININDTDDDGETPLMAAIACSMLDVAEELVKRGARINIQDKQNHTALQYAVRGRHTQMAK 297
            |::...|:|..|..|.|.|:.|:.|....:...|:::...::.||....||.:|||...|..:.:
Human   291 LIKKKANLNALDRYGRTALILAVCCGSASIVSLLLEQNIDVSSQDLSGQTAREYAVSSHHNVICQ 355

  Fly   298 LLLERGARRLASQHLLHLAVESNVKELVELLLQYGESLSVWNLKNFTPIMLA----IHRGRHEML 358
            ||.:     ...:.:|.::.|::..|....|....||..:...:|..|..::    |::|....:
Human   356 LLSD-----YKEKQMLKVSSENSNPEQDLKLTSEEESQRLKGSENSQPEEMSQEPEINKGGDRKV 415

  Fly   359 EYLLNVAEEQRK-------------LGLYSDVHDEGLV 383
            |      ||.:|             .|..:|..|:||:
Human   416 E------EEMKKHGSTHMGFPENLPNGATADNGDDGLI 447

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9121NP_608901.1 ANK 151..300 CDD:238125 36/149 (24%)
ANK repeat 151..179 CDD:293786 10/28 (36%)
Ank_2 153..244 CDD:289560 18/91 (20%)
ANK repeat 181..210 CDD:293786 5/29 (17%)
ANK repeat 213..244 CDD:293786 3/31 (10%)
Ank_2 218..304 CDD:289560 20/86 (23%)
ANK 241..362 CDD:238125 29/125 (23%)
ANK repeat 246..277 CDD:293786 7/31 (23%)
ANK repeat 279..304 CDD:293786 8/25 (32%)
Ank_4 311..362 CDD:290365 11/55 (20%)
SOCS_box 518..574 CDD:284857
POTEGNP_001005356.1 Ank_4 143..193 CDD:290365 8/19 (42%)
ANK 167..292 CDD:238125 40/196 (20%)
ANK 1 172..201 12/30 (40%)
ANK repeat 174..203 CDD:293786 12/55 (22%)
Ank_2 177..269 CDD:289560 30/138 (22%)
ANK repeat 205..236 CDD:293786 9/51 (18%)
ANK 2 205..234 9/49 (18%)
ANK 233..357 CDD:238125 36/156 (23%)
ANK repeat 238..269 CDD:293786 10/31 (32%)
ANK 3 238..267 10/29 (34%)
Ank_2 243..335 CDD:289560 26/124 (21%)
ANK repeat 271..302 CDD:293786 8/63 (13%)
ANK 4 271..300 8/61 (13%)
ANK repeat 304..335 CDD:293786 7/31 (23%)
ANK 5 304..333 6/29 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000728
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.