DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9121 and Ankrd30a

DIOPT Version :8

Sequence 1:NP_608901.1 Gene:CG9121 / 33732 FlyBaseID:FBgn0031675 Length:600 Species:Drosophila melanogaster
Sequence 2:XP_008760352.2 Gene:Ankrd30a / 295999 RGDID:1309783 Length:1209 Species:Rattus norvegicus

Alignment Length:225 Identity:71/226 (31%)
Similarity:108/226 (48%) Gaps:18/226 (8%)


  Fly   132 QCCVSCREHDPHLYDADVATPLHYAAYWGHEECVRILLEHNAPINVLNNDGYAPLHLGAGFAGVT 196
            |..:|..:|..|..|....|.||:|..:||.|.|.:||.:|..|:..:.:...||     ...|.
  Rat    62 QKMISLGKHSVHDRDFKQRTALHFACAYGHVEVVSVLLRNNCDIDAADRNSITPL-----MKAVQ 121

  Fly   197 E-------LLIKHGALVNAKTLSDGKTALHMAIESKCAESARLLLQTNININDTDDDGETPLMAA 254
            .       .|:||||..| :...:|.|:||.|:.......|:.||:.:.|:...:.||.|||:.|
  Rat   122 NWTYECVCTLLKHGADPN-RMDKNGNTSLHYAVSEDNQTLAKCLLKYSANLEQKNKDGFTPLLLA 185

  Fly   255 IACSMLDVAEELVKRGARINIQDKQNHTALQYAVRGRHTQMAKLLLERGA----RRLASQHLLHL 315
            :..:.:::|:.|||:||.|::.|:.....|.||:|.....|..|||:.|.    :.:.....|..
  Rat   186 LKENKIEMAKFLVKKGANIHVFDEMKRNTLLYAIRWDSKDMVNLLLDEGIDFFFKDVFGWTALRY 250

  Fly   316 AVESNVKELVELLLQYGESLSVWNLKNFTP 345
            |:|...|...|:|:.|.|.|...| ||..|
  Rat   251 AIEGTSKGSREILMNYDEKLRRKN-KNGIP 279

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9121NP_608901.1 ANK 151..300 CDD:238125 51/156 (33%)
ANK repeat 151..179 CDD:293786 12/28 (43%)
Ank_2 153..244 CDD:289560 29/98 (30%)
ANK repeat 181..210 CDD:293786 9/36 (25%)
ANK repeat 213..244 CDD:293786 9/31 (29%)
Ank_2 218..304 CDD:289560 30/86 (35%)
ANK 241..362 CDD:238125 36/110 (33%)
ANK repeat 246..277 CDD:293786 13/31 (42%)
ANK repeat 279..304 CDD:293786 9/25 (36%)
Ank_4 311..362 CDD:290365 13/36 (36%)
SOCS_box 518..574 CDD:284857
Ankrd30aXP_008760352.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000728
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.