DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9121 and M60.7

DIOPT Version :8

Sequence 1:NP_608901.1 Gene:CG9121 / 33732 FlyBaseID:FBgn0031675 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_509394.1 Gene:M60.7 / 187467 WormBaseID:WBGene00019782 Length:452 Species:Caenorhabditis elegans

Alignment Length:491 Identity:100/492 (20%)
Similarity:179/492 (36%) Gaps:161/492 (33%)


  Fly   151 TPLHYAAYWGHEECVRILLEHNAPINVLNNDGYAPLHLGA--GFAGVTELLIKHGALVNAKTLSD 213
            ||||||.|..::...::||...|.:..::|.|.:.|||.|  |...:.:||:::..:|......:
 Worm    50 TPLHYACYINYQAAAKLLLNLGAKVQAVDNIGCSALHLCAEHGHYRMIKLLLQYMKVVEQYETPE 114

  Fly   214 GKTA------------LHMAIESKCAESARLLLQTNININDTDDDGETPLMAAIACSMLDVAEEL 266
            .:..            |.:||::...:.|||||....|.|....||  |.:..::....:..|.|
 Worm   115 FRAGDKYPQRENVDEPLRLAIKNGHYDCARLLLTNGANANAIYFDG--PEITQVSPLDTNFLELL 177

  Fly   267 VKRGARINIQDKQNHTALQYAVRGRHTQMAKLLLERG--ARRLASQHLLHLAVESNVKELVELLL 329
            ::.||..|:.|::..|.:..|.|         |.::|  |.|:..:..||.|:.|...:||:.::
 Worm   178 LEFGADPNVFDRKGLTPIMKACR---------LRDKGIEAIRILLKSALHFALLSGNHDLVKFMI 233

  Fly   330 QYGESLSV-WNLKNFTPIMLAIHRGRHEMLEYLLNVAEEQRKLGLYSDVHDEGLVLFAVQQNFWV 393
            ..|.:::: ...:..:||.:|:                      |..|.|               
 Worm   234 ANGSNVNMDEKYEKPSPIDIAV----------------------LKDDPH--------------- 261

  Fly   394 KEFSRILRVLL--AKSPSARNDFYDSCAPTIVCGLIYCHTPLSRAINLHRLEVAEFLIHEGCNL- 455
                 :|:::|  ..:|:|.:.:..||.....|..:           |::.::.|.|:..|.:: 
 Worm   262 -----LLKIVLDAGANPNAVHTYIGSCLHLASCSSL-----------LNQYQIVELLLEHGADMN 310

  Fly   456 -------------------------------------AQI--------CREHVVNELRSNCTPTR 475
                                                 |::        ||..:.|.|:......:
 Worm   311 LQHQFPDGSRLKSPFVEYFRSNDSIDAKVVKLFITHGAKVVMRNPLHDCRGQLRNVLKLAALQNQ 375

  Fly   476 LAFARLLCNAGFQFPHK---HRPLPKDWPPARLEFEREMCLLGTQPRSLQSLARLEIRRSLLRCL 537
            .....||...|.|:.:|   ..|||       .:.:.::......|.|||.|.|::||.:     
 Worm   376 PEVLELLLGLGEQYDNKAIERLPLP-------TQLKTDISERAKNPHSLQHLCRIQIRDT----- 428

  Fly   538 QTRPEVQERYLPTQERSSLGRIVDEFAIPATLKRYL 573
                      :.|.|..:|       .||..||.||
 Worm   429 ----------VQTSEYKTL-------PIPEYLKAYL 447

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9121NP_608901.1 ANK 151..300 CDD:238125 43/163 (26%)
ANK repeat 151..179 CDD:293786 10/28 (36%)
Ank_2 153..244 CDD:289560 28/105 (27%)
ANK repeat 181..210 CDD:293786 9/31 (29%)
ANK repeat 213..244 CDD:293786 10/43 (23%)
Ank_2 218..304 CDD:289560 24/88 (27%)
ANK 241..362 CDD:238125 27/124 (22%)
ANK repeat 246..277 CDD:293786 8/31 (26%)
ANK repeat 279..304 CDD:293786 5/27 (19%)
Ank_4 311..362 CDD:290365 10/52 (19%)
SOCS_box 518..574 CDD:284857 17/57 (30%)
M60.7NP_509394.1 ANK repeat 47..78 CDD:293786 10/28 (36%)
ANK 48..213 CDD:238125 46/174 (26%)
Ank_2 52..155 CDD:289560 28/103 (27%)
ANK repeat 121..155 CDD:293786 10/34 (29%)
Ank_2 170..241 CDD:289560 20/80 (25%)
ANK 214..312 CDD:238125 24/151 (16%)
ANK repeat 215..243 CDD:293786 7/28 (25%)
Ank_2 217..312 CDD:289560 24/148 (16%)
ANK repeat 245..277 CDD:293786 10/74 (14%)
ANK repeat 279..312 CDD:293786 7/44 (16%)
ANK 282..>378 CDD:295348 12/107 (11%)
ANK repeat 320..354 CDD:293786 1/34 (3%)
SOCS 408..449 CDD:128549 17/63 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I3954
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.