DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9121 and mlt-2

DIOPT Version :8

Sequence 1:NP_608901.1 Gene:CG9121 / 33732 FlyBaseID:FBgn0031675 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_492036.2 Gene:mlt-2 / 172459 WormBaseID:WBGene00007252 Length:668 Species:Caenorhabditis elegans

Alignment Length:480 Identity:103/481 (21%)
Similarity:173/481 (36%) Gaps:134/481 (28%)


  Fly   138 REHDPHL--YDADVATPLHYAAYWGHEECVRILLEHNAPINVLNNDGYAPLHLGA--GFAGVTEL 198
            |:...|:  .|.|..|.||.||..|:.:.|..||::.|.|:.:|:.|....|..|  |...|.:.
 Worm    36 RDKKVHIDSVDDDQVTALHIAAAMGNNKLVVRLLDYGANIHAVNHLGMTAYHYAAREGKLAVLDT 100

  Fly   199 LIKHGALVNAKTLSDGKTALHMAIESKCAESARLLLQTNININDTDDDGE----TPLMAAIACSM 259
            |::.||..| :|.:.|.|||.:|.....|:..|.|::.:   |:|....:    |||:.|.....
 Worm   101 LMQRGASKN-QTTALGVTALTLACAGGHADVVRRLIRIS---NETPRSKQSLAPTPLIVATCSKS 161

  Fly   260 LDVAEELVKRGARINIQDKQ----NHTALQYAV---RGRHTQMAKLLLERGA----RRLASQHLL 313
            ..:...|.  ..|:|:.:..    |.|||..|:   .|  ..|.:.|::.||    :.|..:...
 Worm   162 PQICSYLA--DFRVNLDESMKNLGNLTALSMAIVCTPG--VYMVRTLIDLGASVNKKGLGDKTAE 222

  Fly   314 HLAVESNVKELVELLLQYGESLSVWN--------LKN---------------FTPIMLA-----I 350
            .||:..|.|:|:....:.....|..|        :||               .:|:|.|     |
 Worm   223 ELAIMLNRKDLIHFFNEKKSYRSRMNADSDVRKEIKNDHIIERELGAPAQNGVSPLMYATTVRSI 287

  Fly   351 HRGRHEMLEYLLNVAEEQRKLGLYSDVHDEGLVLFAVQQNFWVKEFSRILRV------------- 402
            :..:|.:|       .....:.:..::|...|            :.:.:|||             
 Worm   288 NSAKHLVL-------HRDSDVNMRDNLHITSL------------QIASLLRVDDIIPLLLQRRAD 333

  Fly   403 --LLAKSPSARNDFY----DSCAPTIVCGLIYCHTPLSRAINLHRLEVAEFLIHEGCNLAQICRE 461
              ::.|..|...|.:    |...|..:.|.::||.|:....||:.                 ...
 Worm   334 VTVVNKYGSTAYDLFLLSCDFLEPGQLRGQLHCHRPIDSKSNLNS-----------------SSS 381

  Fly   462 HVVNELRSNCTPTRLAFARLLCNAGFQFPHKHRPL----PKDWPPARLEFEREMCLLGTQPRSLQ 522
            ::...|||.         .:|...|.|.......:    ||.|..|:.::         ||..|:
 Worm   382 NIYKALRSQ---------GILTKVGSQIGINSAKIELIEPKHWLAAKTKY---------QPAKLR 428

  Fly   523 SLARLEIRRSLLRCLQT--RPEVQE 545
            :..:......:|:..:.  |||..|
 Worm   429 NNYKFASVEDILKSCKVAKRPETNE 453

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9121NP_608901.1 ANK 151..300 CDD:238125 47/162 (29%)
ANK repeat 151..179 CDD:293786 11/28 (39%)
Ank_2 153..244 CDD:289560 31/93 (33%)
ANK repeat 181..210 CDD:293786 9/31 (29%)
ANK repeat 213..244 CDD:293786 10/31 (32%)
Ank_2 218..304 CDD:289560 23/97 (24%)
ANK 241..362 CDD:238125 35/164 (21%)
ANK repeat 246..277 CDD:293786 7/35 (20%)
ANK repeat 279..304 CDD:293786 9/32 (28%)
Ank_4 311..362 CDD:290365 15/79 (19%)
SOCS_box 518..574 CDD:284857 7/31 (23%)
mlt-2NP_492036.2 Ank_2 22..111 CDD:289560 25/76 (33%)
ANK 43..168 CDD:238125 38/129 (29%)
ANK repeat 51..79 CDD:293786 11/28 (39%)
ANK repeat 81..112 CDD:293786 10/32 (31%)
Ank_2 119..214 CDD:289560 24/102 (24%)
ANK repeat 144..179 CDD:293786 7/37 (19%)
ANK repeat 181..214 CDD:293786 10/35 (29%)
ANK <269..347 CDD:238125 14/97 (14%)
ANK repeat 273..305 CDD:293786 6/39 (15%)
Ank_5 293..347 CDD:290568 9/73 (12%)
ANK repeat 307..338 CDD:293786 5/43 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
10.960

Return to query results.
Submit another query.