DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9121 and asb3

DIOPT Version :8

Sequence 1:NP_608901.1 Gene:CG9121 / 33732 FlyBaseID:FBgn0031675 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_001191998.1 Gene:asb3 / 100497433 XenbaseID:XB-GENE-989169 Length:522 Species:Xenopus tropicalis

Alignment Length:557 Identity:126/558 (23%)
Similarity:197/558 (35%) Gaps:162/558 (29%)


  Fly    42 TAVGTAAILGDAELLELLLQ---SCEEPELN---VFHQS----NTDSLEIERTPEGMEKLEWVDE 96
            ::||.||.:|||:.|..|::   |.:.|:..   ..|::    :|..|::               
 Frog    12 SSVGHAARIGDAKSLRKLIKKGSSVDVPDNRGWMPIHEAAFSKSTHCLQL--------------- 61

  Fly    97 FENSAENGAGSGEEDSQLYQYYAKTFETTGEFISSQCCVSCREHDPHLYDADVATPLHYAAYWGH 161
            ..:||.:.:          ...|||||  ||                       |.||.||..|.
 Frog    62 LIHSAPSSS----------YIRAKTFE--GE-----------------------TALHLAAKSGS 91

  Fly   162 EECVRILLEHNAPINVLNNDGYAPLHLG--AGFAGVTELLIKHGALVNAKTLSDGKTALHMAIES 224
            ..||::||:..|..|.:.|:...||.|.  .|...|.|||:|:.|.:|......|...||.|...
 Frog    92 VRCVQLLLQAGADPNEVTNEETTPLFLAVEGGHKEVVELLLKNKANINGPHSCSGWNPLHQASLM 156

  Fly   225 KCAESARLLLQTNININDTDDDGETPLMAAIACSMLDVAEELVKRGARINIQDKQNHTALQYAVR 289
            ...:...|||:..::....||.|.||...|......:....|:..||..:.|.|...|.|..|.:
 Frog   157 GRTDIILLLLENGVDKECEDDFGITPTFIASQYGKYESLNLLLLHGANSDCQAKDKATPLFIAAQ 221

  Fly   290 GRHTQMAKLLLERGARRLASQHL----------LHLAVESNVKELVELLLQYGESLSVWNLKNFT 344
            ..|.:..:|||.:|    |..:|          :|.|.:....:.::|||...:|.........:
 Frog   222 EGHDKCVELLLSKG----ADPNLYCNDDNWQLPIHAAAQMGQSKTLDLLLPVTDSAGGVENGKVS 282

  Fly   345 PIMLAIHRGRHEMLEYLLNVAEEQRKLGLYSDVHDEGLVLFAVQQNFWVKEFSRILRVLLAKSPS 409
            |:..|::.|..:.||.||                                        :...||.
 Frog   283 PVYSAVYGGHKDCLEKLL----------------------------------------MSGYSPE 307

  Fly   410 ARNDFYDSCAPTIVCGLIYCHTPLSRAINLHRLEVAEFLIHEGCNLA----QICREHVVNE---- 466
            |:.           |.|..|.||:.........|:...|:..|..|:    ..|.|:...:    
 Frog   308 AQK-----------CPLFGCETPMCMVFQRRHFEMVPVLLKYGFRLSSAHLMCCLENKTFDLFRY 361

  Fly   467 -LRSNC-TPTR---LAFARLLCNAGFQFPHKHRPLPKDWPPARLEFEREMCLLGTQPRSL----- 521
             |...| .|:.   .|.::.:|||..::        ::|.|       ::.|.|..|..|     
 Frog   362 FLNQRCPLPSGKEVAALSQYVCNAQREW--------EEWLP-------DLLLAGFDPLLLLEATW 411

  Fly   522 QSLARLEIRRSLLRCLQTR--PEVQERYLPTQERSSL 556
            .|.|..:|....|.....:  |...|:||.||.::|:
 Frog   412 MSSANDDILNFTLEFSDWKRLPRHVEQYLSTQGKASV 448

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9121NP_608901.1 ANK 151..300 CDD:238125 48/151 (32%)
ANK repeat 151..179 CDD:293786 12/28 (43%)
Ank_2 153..244 CDD:289560 30/93 (32%)
ANK repeat 181..210 CDD:293786 11/31 (35%)
ANK repeat 213..244 CDD:293786 7/31 (23%)
Ank_2 218..304 CDD:289560 25/86 (29%)
ANK 241..362 CDD:238125 33/131 (25%)
ANK repeat 246..277 CDD:293786 8/31 (26%)
ANK repeat 279..304 CDD:293786 8/25 (32%)
Ank_4 311..362 CDD:290365 13/61 (21%)
SOCS_box 518..574 CDD:284857 13/47 (28%)
asb3NP_001191998.1 Ank_2 16..106 CDD:289560 32/140 (23%)
ANK repeat 42..76 CDD:293786 7/59 (12%)
ANK 74..199 CDD:238125 45/150 (30%)
ANK repeat 78..109 CDD:293786 15/56 (27%)
Ank_2 83..176 CDD:289560 30/93 (32%)
ANK repeat 111..142 CDD:293786 11/31 (35%)
ANK repeat 145..176 CDD:293786 7/31 (23%)
ANK 146..267 CDD:238125 32/125 (26%)
Ank_2 150..240 CDD:289560 26/94 (28%)
ANK repeat 178..209 CDD:293786 8/31 (26%)
ANK repeat 211..240 CDD:293786 9/33 (27%)
Ank_2 216..309 CDD:289560 25/137 (18%)
Ank_2 287..364 CDD:289560 21/128 (16%)
ANK repeat 314..339 CDD:293786 5/25 (20%)
SOCS_ASB3 456..506 CDD:239692
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.