DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9121 and POTEB2

DIOPT Version :8

Sequence 1:NP_608901.1 Gene:CG9121 / 33732 FlyBaseID:FBgn0031675 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_001264232.1 Gene:POTEB2 / 100287399 HGNCID:48327 Length:544 Species:Homo sapiens

Alignment Length:337 Identity:85/338 (25%)
Similarity:132/338 (39%) Gaps:76/338 (22%)


  Fly    16 SGDFEQALGCIMQ---GAQASYVSPTC---GRTAVGTAAILGDAELLELLLQSCEEPELNVFHQS 74
            |||.:.:....::   |....:..|.|   |::.|||.....|:..:        ||..:|    
Human    46 SGDHDDSFMKTLRSKMGKWCCHCFPCCRGSGKSNVGTWGDYDDSAFM--------EPRYHV---- 98

  Fly    75 NTDSLEIERTPEGMEKLE----WVDEFENSAENGAGSGEEDSQLYQYYAKTFETTGEFISSQCCV 135
                     ..|.::||.    |                                |:.......|
Human    99 ---------RREDLDKLHRAAWW--------------------------------GKVPRKDLIV 122

  Fly   136 SCREHDPHLYDADVATPLHYAAYWGHEECVRILLEHNAPINVLNNDGYAPLHLGAGFAGVTE--- 197
            ..|:.|.:..|....|.||.|:..|:.|.|::||:....:|||:|.....| :.|......|   
Human   123 MLRDTDMNKRDKQKRTALHLASANGNSEVVQLLLDRRCQLNVLDNKKRTAL-IKAVQCQEDECVL 186

  Fly   198 LLIKHGALVNAKTLSD--GKTALHMAIESKCAESARLLLQTNININDTDDDGETPLMAAIACSML 260
            :|::|||..|   :.|  |.||||.||.::....|:.||....:|...:..|.|||:..:.....
Human   187 MLLEHGADGN---IQDEYGNTALHYAIYNEDKLMAKALLLYGADIESKNKCGLTPLLLGVHEQKQ 248

  Fly   261 DVAEELVKRGARINIQDKQNHTALQYAVRGRHTQMAKLLLER----GARRLASQHLLHLAVESNV 321
            :|.:.|:|:.|.:|..|:...|||..||......:..||||:    .::.|:.|.....||.|:.
Human   249 EVVKFLIKKKANLNALDRYGRTALILAVCCGSASIVNLLLEQNVDVSSQDLSGQTAREYAVSSHH 313

  Fly   322 KELVELLLQYGE 333
            ..:.|||..|.|
Human   314 HVICELLSDYKE 325

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9121NP_608901.1 ANK 151..300 CDD:238125 50/154 (32%)
ANK repeat 151..179 CDD:293786 12/28 (43%)
Ank_2 153..244 CDD:289560 32/96 (33%)
ANK repeat 181..210 CDD:293786 8/32 (25%)
ANK repeat 213..244 CDD:293786 12/33 (36%)
Ank_2 218..304 CDD:289560 27/90 (30%)
ANK 241..362 CDD:238125 29/98 (30%)
ANK repeat 246..277 CDD:293786 9/31 (29%)
ANK repeat 279..304 CDD:293786 9/29 (31%)
Ank_4 311..362 CDD:290365 8/24 (33%)
SOCS_box 518..574 CDD:284857
POTEB2NP_001264232.1 ANK 130..255 CDD:238125 40/129 (31%)
ANK 1 135..167 12/32 (38%)
ANK repeat 137..166 CDD:293786 12/29 (41%)
ANK 2 168..200 9/36 (25%)
ANK repeat 168..199 CDD:293786 8/35 (23%)
ANK 196..320 CDD:238125 39/127 (31%)
ANK 3 201..233 11/32 (34%)
ANK repeat 201..232 CDD:293786 11/31 (35%)
ANK 4 234..266 10/32 (31%)
ANK repeat 234..265 CDD:293786 9/31 (29%)
ANK 5 267..299 9/32 (28%)
ANK repeat 267..298 CDD:293786 9/31 (29%)
SMC_N <412..>542 CDD:330553
CCDC144C 489..>542 CDD:317340
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000728
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.