DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Col4a1 and Col27a1

Sequence 1:NP_723044.1 Gene:Col4a1 FlyBaseID:FBgn0000299 Length:1779 Species:Drosophila melanogaster
Sequence 2:XP_017175771.1 Gene:Col27a1 MGIID:2672118 Length:1871 Species:Mus musculus

Alignment Length:1825 Identity:602/1826 (33%)
Similarity:759/1826 (42%) Gaps:496/1826 (27%)


  Fly    47 PKFPIDDSYDIVDSAGVARGDLPP-----KNCTAGYA-------GCVPKCIAEK----------G 89
            |:.|:.....:..:.|:::....|     |:.|..:|       ..|||.:.:.          |
Mouse   429 PRPPVPSPQPLRPTTGLSKKFTNPTVAKSKSKTTSWASKPVLARSSVPKTLQQTVLSQSPVSYLG 493

  Fly    90 NRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPA 154
            ::.|...|.|.|    :|.|....|:.|....    |.|.:...|...|.... |...|  :.| 
Mouse   494 SQTLAPALPPLG----VGNPRTMPPTRDSALT----PAGSKKFTGRETSKKTR-QKSSP--RKP- 546

  Fly   155 GNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGE-------PAKENGDYAKG 212
             .|.:||.:.:|.                 .||    .|.:|..:..       ||     |...
Mouse   547 -EPLSPGKSARDA-----------------SPR----DLTTKPSRPSTPALVLAPA-----YLLS 584

  Fly   213 EKGEPGWRGTAG------LAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGA 271
            ...:|    |:.      |.||..||...|..|..|..|..||.|..||             ||:
Mouse   585 SSPQP----TSSSFPFFHLLGPTPFPMLMGPPGSKGDCGLPGPPGLPGL-------------PGS 632

  Fly   272 PGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGP 336
            ||.:|.:|.|             ||.|:.|..|.||..|:||:||.......||.||..||||..
Mouse   633 PGARGPRGPP-------------GPYGNPGPPGPPGAKGQKGDPGLSPGQAHDGAKGNMGLPGLS 684

  Fly   337 GDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPG 401
            |:         ||..|:||.:|.||..|.||..||.|..|..||.|.||..|.|||       .|
Mouse   685 GN---------PGPLGRKGHKGHPGAAGHPGEQGQPGPEGSPGAKGYPGRQGFPGP-------VG 733

  Fly   402 PPGPKGPRGYVGAPGPQGLNGVD---GLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLN 463
            .|||||.|||:|.||..||.|.|   ||||..|..|:.|..|.||..|..||||..|..|..||.
Mouse   734 DPGPKGSRGYIGLPGLFGLPGSDGERGLPGVPGKRGEMGRPGFPGDFGERGPPGLDGNPGEIGLP 798

  Fly   464 GP---------KGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFK 519
            ||         .|::||:|:|||.|.:|..|..|.|  |::|.||:.|:||..|..|.:|::|..
Mouse   799 GPPGVLGLIGDTGALGPVGYPGPKGMKGLMGGVGEP--GLKGDKGEQGVPGVSGDPGFQGDKGSH 861

  Fly   520 GNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTS 584
            |..|.||    || |.||..|..|.||..|.||.||.:   |..||:         ||.||.|..
Mouse   862 GLPGLPG----GR-GKPGPLGKAGDKGSLGFPGPPGPE---GFPGDI---------GPPGDNGPE 909

  Fly   585 GLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLI 649
            |:.|.||..|..|||               ||.||.|::|..|..|:||..|:||:         
Mouse   910 GMKGKPGARGLPGPP---------------GQLGPEGDEGPMGPPGVPGLEGQPGR--------- 950

  Fly   650 EPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPG 714
                  ||:||.|   |:.|.||..|.||.|||.||.|..|..||.|.||               
Mouse   951 ------KGFPGRP---GLDGSKGEPGDPGRPGPVGEQGLMGFIGLVGEPG--------------- 991

  Fly   715 IPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGED 779
                 |.||         |||:|..|..|..|..||          .|:.|.||..|.||.||..
Mouse   992 -----IVGE---------KGDRGVMGPPGAPGPKGS----------MGHPGTPGGIGNPGEPGPW 1032

  Fly   780 GSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGP 844
            |.||.||..|::|..|.:||.|.:||.   |.:|.||.:|.||..|.||:.|.:|..|..|..|.
Mouse  1033 GPPGSRGLPGMRGAKGHRGPRGPDGPA---GEQGSKGLKGRVGPRGRPGQPGQQGAAGERGHSGA 1094

  Fly   845 RGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGE 909
            :|..||  |||.||||..||.||.|.:||.||:|.||..|..|.||..|:.||||.||.      
Mouse  1095 KGFLGI--PGPSGPPGAKGLPGEPGSQGPQGPVGPPGEMGPKGPPGAVGEPGLPGDSGM------ 1151

  Fly   910 KGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTG 974
            |||:||:      ||||..|:.|.||..|.:|:.|.   ||..|.|||||.||.|          
Mouse  1152 KGDLGPL------GPPGEQGLIGQRGEPGLEGDHGP---VGPDGLKGDRGDPGPD---------- 1197

  Fly   975 APGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMP 1039
                          |..|:||..||.|.|      |.||.||:.|:.|.:|..|..|::|..|..
Mouse  1198 --------------GEHGEKGQEGLKGED------GSPGPPGITGVPGREGKPGKQGEKGQRGAK 1242

  Fly  1040 GEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLA-------V 1097
            |.||:||:.|..|.||      |.|..|.|||.|.||..||.|.||..|.:|.||||       :
Mouse  1243 GAKGHQGYLGEMGIPG------EPGPPGTPGPKGSRGTLGPTGAPGRMGAQGEPGLAGYNGHKGI 1301

  Fly  1098 HGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAG 1162
            .|..||||.||::|..|.||:           .:|..|.||::|.|                   
Mouse  1302 TGPLGPPGPKGEKGDQGEDGK-----------TEGPPGPPGDRGPV------------------- 1336

  Fly  1163 APGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGD 1227
                    |||||:||||..|.||.:      |:||..|.||.      :||||.|         
Mouse  1337 --------GDRGDRGEPGDPGYPGQE------GVQGLRGEPGQ------QGQPGHP--------- 1372

  Fly  1228 KGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGA-------------------SGLN 1273
                |.||..|.||.:||.|..|..|.||..|.||.|....:                   .||.
Mouse  1373 ----GPRGRPGPKGSKGEEGPKGKPGKAGPSGRRGTQVSCHSFSVTFYVLLRRFNQLLLYLQGLQ 1433

  Fly  1274 GIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLP 1338
            |:|      ||||.:                 ||.|.:|..|:.|:.|..|.||..|:.|..|.|
Mouse  1434 GLP------GPRGVV-----------------GRQGPEGTAGSDGIPGRDGRPGYQGDQGNDGDP 1475

  Fly  1339 GPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGP 1403
            ||:||||.:|..|:||.||..|..||.|..||.|..||.|.:|..|..|..|.:|:.|.:|..|.
Mouse  1476 GPVGPAGRRGNPGVAGLPGAQGPPGFKGESGLPGQLGPPGKRGTEGGTGLPGNQGEPGSKGQPGD 1540

  Fly  1404 SGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKG 1468
            |         |:.|:||:.|..||.|.||:.||   ||..|..|.|||.|::   |::.|||..|
Mouse  1541 S---------GEMGFPGVAGLFGPKGPPGDIGF---KGIQGPRGPPGLMGKE---GIIGPPGMLG 1590

  Fly  1469 EPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGEPGE------- 1526
            ..|.|   ||||:   .|.||.:|:||.||..|.|         |||||.|....|.:       
Mouse  1591 PSGLP---GPKGD---RGSRGDLGLQGPRGPPGPR---------GRPGPPGPPWHPIQFQQDDLG 1640

  Fly  1527 ---RGYEGAIGLIGQKGEPGAPAPAALDYLTGILITRHSQSETVPACSAGHTELWTGYSLLYVDG 1588
               :.:..|.|.:..:.....|...|||....|..|.|..|..:.:..   |.|.|       ..
Mouse  1641 AAFQTWMDAQGAVRSEQGYSYPDQLALDQGGEIFKTLHYLSNLIQSIK---TPLGT-------KE 1695

  Fly  1589 NDYAHNQDLGSPGSCVPRFS-----TLPVLSCGQNNV---CNYASRNDKTFWLTTNAAIPMMPVE 1645
            |.....:||   ..|..|.:     ..|.|.|..:.:   ||:          |......:.|:.
Mouse  1696 NPARVCRDL---MDCEQRMADGTYWVDPNLGCSSDTIEVSCNF----------TQGGQTCLKPIT 1747

  Fly  1646 NIEIRQYISRC------VVCEAPANVIAVHSQTIEVPDCPNGW-EGLWIGYSFLMHTAVGNGGGG 1703
            ..:....:||.      ::.......|.:|...:.|      | ||  .|.|............|
Mouse  1748 ASKAEFAVSRVQMNFLHLLSSEGTQHITIHCLNMTV------WQEG--PGRSSARQAVRFRAWNG 1804

  Fly  1704 QALQSPGSCLEDFRATPFIECNGAK---GTCHFYETMTSFW--------MYNLESSQPFERPQQQ 1757
            |..::.|    .||  |.:..:|.|   |..|  :|:.:|.        :.::::..|....:|.
Mouse  1805 QVFEAGG----QFR--PEVSMDGCKVHDGRWH--QTLFTFRTQDPQQLPIVSVDNLPPVSSGKQY 1861

  Fly  1758 TIKAG 1762
            .::.|
Mouse  1862 RLEVG 1866

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Col4a1NP_723044.1 Collagen 104..161 CDD:189968 13/57 (23%)
Collagen 322..380 CDD:189968 25/58 (43%)
Collagen 413..465 CDD:189968 27/55 (49%)
Collagen 499..561 CDD:189968 26/62 (42%)
Collagen 574..632 CDD:189968 21/58 (36%)
Collagen 657..714 CDD:189968 23/57 (40%)
Collagen 765..824 CDD:189968 28/59 (47%)
Collagen 854..911 CDD:189968 30/57 (53%)
Collagen 884..943 CDD:189968 26/59 (44%)
Collagen 923..982 CDD:189968 22/59 (37%)
Collagen 1028..1085 CDD:189968 26/57 (46%)
Collagen 1229..1287 CDD:189968 25/77 (32%)
Collagen 1318..1376 CDD:189968 29/58 (50%)
Collagen 1399..1458 CDD:189968 23/59 (39%)
Collagen 1477..1534 CDD:189968 22/67 (33%)
C4 1555..1662 CDD:128421 21/121 (17%)
C4 1663..1777 CDD:128421 23/113 (20%)
Col27a1XP_017175771.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126592
Panther 1 1.100 O PTHR24023
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.