DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Col4a1 and Col4a2

Sequence 1:NP_723044.1 Gene:Col4a1 FlyBaseID:FBgn0000299 Length:1779 Species:Drosophila melanogaster
Sequence 2:XP_001076134.3 Gene:Col4a2 RGDID:1308085 Length:1708 Species:Rattus norvegicus

Alignment Length:1864 Identity:798/1865 (43%)
Similarity:966/1865 (52%) Gaps:338/1865 (18%)


  Fly    62 GVARGDLP--PKNCTAGYAGCVPKCIAEKGNRGLPGPLGPTGLKGE---MGFPGMEGPSGDKGQK 121
            ||.:.|:|  .::|:   .||  :|..|||.||.||.:||.|..|.   .||||::|..||||::
  Rat    34 GVKKSDVPCGGRDCS---GGC--QCFPEKGARGQPGEVGPQGYNGPPGLQGFPGLQGRKGDKGER 93

  Fly   122 GDPGPYGQRGDKGER---GSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGM 183
            |.|||.|.:||.|.|   |.||..|..|.||..||.|.||..|.||..|..|..|..|..|..|:
  Rat    94 GAPGPTGPKGDVGARGVSGFPGADGIPGHPGQGGPRGRPGYDGCNGTRGDAGPQGPSGTGGFPGL 158

  Fly   184 PGPRGYAGQLGSKGEKGEP---AKENGDYAKGE----------KGEPGWRGTAGLAGPQGFPGEK 235
            |||:      |.||:||||   :||:.|..:||          :|.||..|..|..||.|.||..
  Rat   159 PGPQ------GPKGQKGEPYALSKEDRDKYRGETGRPMLFVCLQGPPGRPGPIGQMGPMGAPGRP 217

  Fly   236 GERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGP---R 297
            |..|..||.|..|.|| .|..||||       :.|..|..|..|.|:....:.||.:...|   :
  Rat   218 GPPGPPGPKGQPGNRG-LGFYGEKG-------EKGDVGQPGPNGIPSDITLIGPTPSTYHPDMYK 274

  Fly   298 GDMGQKGEPGLVG--RKGE------------PGPEGDTGLDGQKGEKGL-----PGGP-GDRGRQ 342
            |:.|.:||||:.|  .|||            ||.:|:.|:.||||.:||     |.|| |.:|.:
  Rat   275 GEKGSQGEPGIPGITLKGEEGIMGFPGTRGFPGLDGEKGVSGQKGSRGLDGFQGPSGPRGPKGER 339

  Fly   343 GNFGPPGSTG-------QKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTP 400
            |..||||...       .||.||:||..|..|.||.:|||      |.||.:||||...|...:.
  Rat   340 GELGPPGPPAYSPHPSLAKGARGDPGFQGAHGEPGSRGEP------GDPGPVGPPGLSIGDEDSK 398

  Fly   401 -GPPGPKGPRGYVGAPGPQ----GLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTA 460
             |.||..||:|:.|.|||.    |..|.||.|||||.            ||..||||..|     
  Rat   399 RGLPGEMGPKGFSGEPGPSAYYPGPPGADGKPGPQGL------------PGPAGPPGPDG----- 446

  Fly   461 GLNGPKGSIGPIGHPGP---PGPEGQKGDAGLPGYGIQGSKGDAG-------IPGYPGLKGSKGE 515
            .|.|.|||.|.:|:|||   ||..|||           |.||:||       |||.|||.|.||.
  Rat   447 FLFGLKGSEGRVGYPGPSGFPGGRGQK-----------GWKGEAGDCQCGQVIPGLPGLPGPKGF 500

  Fly   516 RGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGD 580
            .|..|..|..||.  |.||..|..|.||.||..|..|.||.|   |:|||      |.....||:
  Rat   501 PGVNGEFGKKGDQ--GDPGLHGIPGFPGFKGAPGIAGAPGPK---GVKGD------SRTITTKGE 554

  Fly   581 KGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCD 645
            :|..|:||:      .|..|:.|.||..|.||..|..||||    ||..|.||..|.||.|    
  Rat   555 RGQPGIPGV------HGMKGDDGVPGRDGLDGFPGLPGPPG----DGIKGPPGDAGLPGTP---- 605

  Fly   646 LSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRD 710
                    |.||:||..|..|          .|:||||||.||.|:.||.|.||..|.|      
  Rat   606 --------GTKGFPGEVGPPG----------QGLPGPKGERGFPGDAGLPGPPGFPGPP------ 646

  Fly   711 GYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTG-MPG 774
            |.||.|||             |..|.|                  :|.|..|.:....|.| :.|
  Rat   647 GLPGTPGQ-------------ADCDTG------------------VKRPIGGGQQVVIQPGCVEG 680

  Fly   775 PPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRN 839
            |.|..|.||..|.||.||..|..|.||..|.:||.|..|:.|.:   |.||.||..|.||..|..
  Rat   681 PAGSPGQPGPPGPTGAKGIRGIPGFPGASGEQGLKGFPGDPGRE---GFPGPPGFMGPRGSKGAP 742

  Fly   840 GQPGPRGEPG-ISRPGPMGPPGLNGLQGE--------KGDRGPTGPIGFPGADGSVGYPGDRGDA 895
            |.|||.|.|| |..|||.||||..|:.||        :||.|..|..|..|..|.:|.||.||..
  Rat   743 GLPGPDGPPGPIGLPGPAGPPGDRGIPGEVLGAQPGARGDAGLPGQPGLKGFPGEIGAPGFRGSQ 807

  Fly   896 GLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGA 960
            |:||:   ||:.|:.|..||.|..|::||||..|..|..||:|..|.||||||.|:||::|:.|.
  Rat   808 GMPGM---PGLKGQPGFPGPSGQPGLSGPPGQHGFPGAPGREGPLGLPGSPGLGGLPGDRGEPGE 869

  Fly   961 PGNDGPKGFAGVT---------------GAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRG 1010
            ||..||.|..||:               |:||.:|.||:||:.|.|||:|:.|:.|..|.:|.:|
  Rat   870 PGEPGPVGMKGVSGDRGDAGVSGERGHPGSPGFKGMAGMPGIPGQKGDRGSPGMDGFQGMLGLKG 934

  Fly  1011 PPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPG--LPGDASEKGQKGEPGPSG 1073
            .||.|   ||||:.|..|.||.:||.|.||.|||:|..|..|||.  |||....||:||:.||.|
  Rat   935 RPGFP---GIKGEAGFFGVPGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMG 996

  Fly  1074 LRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPG 1138
            |:|..|..|..|.|   |:|||:                                |:.|:.|:||
  Rat   997 LKGYLGLKGIQGMP---GVPGLS--------------------------------GIPGLPGRPG 1026

  Fly  1139 -EKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQG---- 1198
             .||:.|..|:||.||:.|.||.:|.||..|:||..|.:||.|..|:.|:.|||||.|..|    
  Rat  1027 FIKGAKGDIGVPGTPGLPGFPGVSGPPGITGFPGFTGSRGEKGTPGVAGVFGETGPTGDFGDIGD 1091

  Fly  1199 ---FTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGD 1260
               ..|:||.|||||:.|.|||..    :.|:||::|:.|:.|..|..|.:|..|..|..|..|.
  Rat  1092 TVDLPGSPGLKGERGVTGIPGLKG----LFGEKGAEGDVGFPGITGMAGAQGSPGLKGQTGFPGL 1152

  Fly  1261 RGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVT-IKGEKGLPGRPGRNGRQGLIGAPGL--IGE 1322
            .|||||.|..|..||||.|||.|..|..|.||:. |:|..||.|.|   |.:|..|:||:  .|:
  Rat  1153 TGLQGPQGEPGRIGIPGDKGDFGWPGVPGRPGIPGIRGISGLHGLP---GTKGFPGSPGVDAHGD 1214

  Fly  1323 RGLPGLAGEPGLVG----LPGPIGPAGSKGERGLAGS---PGQPGQDGFP--------------- 1365
            .|.||..|:.|..|    ||||:|..|.|||:|:.|.   .|.||..|||               
  Rat  1215 PGFPGPTGDRGDRGEANTLPGPVGAPGQKGEQGIPGERGPVGSPGLQGFPGISPPSNISGLPGDV 1279

  Fly  1366 GAPGL------KGDTGP------QGFKGERGLN---GFEGQKGDKGDRGLQGPSGLPGLVGQKGD 1415
            ||||:      :|..||      .|.||:.|.:   ||.|:||..||.|.||..|:.||.|:||.
  Rat  1280 GAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGFPGEKGWVGDPGPQGQPGVHGLPGEKGP 1344

  Fly  1416 TGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPG-PKGEPGQPGRNGPK 1479
            .|..|..||.||.||.|:|   ||||..|..|.||.||..|.||:   || |:....|||..||:
  Rat  1345 KGEQGFMGNTGPSGAVGDR---GPKGPKGDQGFPGAPGSMGSPGI---PGIPQKIAVQPGTMGPQ 1403

  Fly  1480 GEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPK---GDRGEPGERGYEGAIGLIGQKGE 1541
            |..|.||..|.:|.||..|:.|.||..|:.|..||.|..   |.||:.|..|::|.||..|:.|.
  Rat  1404 GRRGLPGALGEMGPQGPPGDPGFRGAPGKAGPQGRGGVSAVPGFRGDQGPMGHQGPIGQEGEPGR 1468

  Fly  1542 PGAPAPAAL---DYLTGILITRHSQSETVPACSAGHTELWTGYSLLYVDGNDYAHNQDLGSPGSC 1603
            ||:|....:   ....|.|:.:|||::..|.|..|..:||:||||||.:|.:.|||||||..|||
  Rat  1469 PGSPGLPGMPGRSVSIGYLLVKHSQTDQEPMCPVGMNKLWSGYSLLYFEGQEKAHNQDLGLAGSC 1533

  Fly  1604 VPRFSTLPVLSCGQNNVCNYASRNDKTFWLTTNAAIPMMPVENIEIRQYISRCVVCEAPANVIAV 1668
            :.||||:|.|.|...:||.|||||||::||:|.|.:|||||...||:.|||||.||||||..|||
  Rat  1534 LARFSTMPFLYCNPGDVCYYASRNDKSYWLSTTAPLPMMPVAEEEIKPYISRCSVCEAPAVAIAV 1598

  Fly  1669 HSQTIEVPDCPNGWEGLWIGYSFLMHTAVGNGGGGQALQSPGSCLEDFRATPFIECNGAKGTCHF 1733
            |||.:.:|.||.||..||||||||||||.|:.||||:|.|||||||||||||||||||.:||||:
  Rat  1599 HSQDVSIPHCPAGWRSLWIGYSFLMHTAAGDEGGGQSLVSPGSCLEDFRATPFIECNGGRGTCHY 1663

  Fly  1734 YETMTSFWMYNLESSQPFERPQQQTIKAGERQSHVSRCQVCMKN 1777
            :....|||:..:........|...|:|||..::|:|||||||||
  Rat  1664 FANKYSFWLTTIPEQNFQSTPSADTLKAGLIRTHISRCQVCMKN 1707

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Col4a1NP_723044.1 Collagen 104..161 CDD:189968 31/63 (49%)
Collagen 322..380 CDD:189968 30/71 (42%)
Collagen 413..465 CDD:189968 22/56 (39%)
Collagen 499..561 CDD:189968 31/69 (45%)
Collagen 574..632 CDD:189968 22/58 (38%)
Collagen 657..714 CDD:189968 24/57 (42%)
Collagen 765..824 CDD:189968 24/60 (40%)
Collagen 854..911 CDD:189968 27/65 (42%)
Collagen 884..943 CDD:189968 27/59 (46%)
Collagen 923..982 CDD:189968 32/74 (43%)
Collagen 1028..1085 CDD:189968 30/59 (51%)
Collagen 1229..1287 CDD:189968 27/58 (47%)
Collagen 1318..1376 CDD:189968 31/88 (35%)
Collagen 1399..1458 CDD:189968 30/59 (51%)
Collagen 1477..1534 CDD:189968 26/60 (43%)
C4 1555..1662 CDD:128421 63/107 (59%)
C4 1663..1777 CDD:128421 70/114 (61%)
Col4a2XP_001076134.3 Collagen 67..121 CDD:189968 26/54 (48%)
Collagen 291..348 CDD:189968 23/57 (40%)
Collagen 489..539 CDD:189968 26/52 (50%)
Collagen 777..834 CDD:189968 25/60 (42%)
Collagen 901..960 CDD:189968 30/62 (48%)
Collagen 1011..1071 CDD:189968 30/92 (33%)
Collagen 1133..1190 CDD:189968 27/57 (47%)
Collagen 1325..1384 CDD:189968 32/62 (52%)
C4 1486..1590 CDD:279721 60/104 (58%)
C4 1595..1705 CDD:279721 67/110 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BAFZ
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H1390
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D41315at33208
OrthoFinder 1 1.000 FOG0000150
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24023
Phylome 1 0.910 0.714 Consistency score
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.