DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Col4a1 and COL24A1

Sequence 1:NP_723044.1 Gene:Col4a1 FlyBaseID:FBgn0000299 Length:1779 Species:Drosophila melanogaster
Sequence 2:XP_016856413.1 Gene:COL24A1 HGNCID:20821 Length:1729 Species:Homo sapiens

Alignment Length:1641 Identity:562/1642 (34%)
Similarity:713/1642 (43%) Gaps:472/1642 (29%)


  Fly   208 DYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAP 272
            :|.:|.||:   .|..|..||.|.||..|:|   ||.|..||.|..||             ||.|
Human   485 EYLRGPKGD---TGPPGPPGPAGIPGPSGKR---GPRGIPGPHGNPGL-------------PGLP 530

  Fly   273 GIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPG 337
            |.||.||:|..|                           .|:|                :||..|
Human   531 GPKGPKGDPGFS---------------------------PGQP----------------VPGEKG 552

  Fly   338 DRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGP 402
            |:|..|..||||..|.||.:|.|||.||||..|..|..|..|:.|.||..|..||.|.       
Human   553 DQGLSGLMGPPGMQGDKGLKGHPGLPGLPGEQGIPGFAGNIGSPGYPGRQGLAGPEGN------- 610

  Fly   403 PGPKGPRGYVGAPGPQGLNGVD---GLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNG 464
            |||||.:|::|:||..|..|.:   |:||.:|..|.||..|.||..|:.||.|..|..|..|..|
Human   611 PGPKGAQGFIGSPGEAGQLGPEGERGIPGIRGKKGFKGRQGFPGDFGDRGPAGLDGSPGLVGGTG 675

  Fly   465 P------KGSIGPIGHPGPPGPEGQKGDAGLPG-YGIQGSKGDAGIPGYPGLKGSKGERGFKGNA 522
            |      :||:||:|..||         ||:|| .|:.|:|      |.||:||.|||:|..|  
Human   676 PPGFPGLRGSVGPVGPIGP---------AGIPGPMGLSGNK------GLPGIKGDKGEQGTAG-- 723

  Fly   523 GAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLP 587
                  :||.||.|                                          ||||..|||
Human   724 ------ELGEPGYP------------------------------------------GDKGAVGLP 740

  Fly   588 GIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEP- 651
            |.||..|..||.|:.|.|      |:.|.:||||.:|..|..|:||..|..|...|..|...|| 
Human   741 GPPGMRGKSGPSGQTGDP------GLQGPSGPPGPEGFPGDIGIPGQNGPEGPKELVILWKHEPF 799

  Fly   652 -----LKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDG 711
                 |.|::|.||.||.||.||.:|..|..|..||:|:   .|:||.:|.||.:|         
Human   800 ISEKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELGPRGK---PGQKGYAGEPGPEG--------- 852

  Fly   712 YPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPP 776
                    :|||         .||:|:.|:.||.|..|        :|     ||.|.||..|..
Human   853 --------LKGE---------VGDQGNIGKIGETGPVG--------LP-----GEVGMTGSIGEK 887

  Fly   777 GEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQ 841
            ||.||||..                        ||:||||..                     |.
Human   888 GERGSPGPL------------------------GPQGEKGVM---------------------GY 907

  Fly   842 PGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGI 906
            |||   ||:  |||:||   .||.|..|.|||      ||:.|..|..|.||..||.|..|..|.
Human   908 PGP---PGV--PGPIGP---LGLPGHVGARGP------PGSQGPKGQRGSRGPDGLLGEQGIQGA 958

  Fly   907 VGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAG 971
            .|||||.|..||.|:.|..|.||..|.:|:.|.:|.|||.|..|:||..|.||..|:.||.|..|
Human   959 KGEKGDQGKRGPHGLIGKTGNPGERGFQGKPGLQGLPGSTGDRGLPGEPGLRGLQGDVGPPGEMG 1023

  Fly   972 VTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLD 1036
            :.|.||..|.:|:.|..|||||.|..|..|..|..|.||.|||||..|::|..||.|.||.:||.
Human  1024 MEGPPGTEGESGLQGEPGAKGDVGTAGSVGGTGEPGLRGEPGAPGEEGLQGKDGLKGVPGGRGLP 1088

  Fly  1037 GMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRA 1101
            |..||||..|.||:.||.|      ..||.|.|||.|:.|..|..|.||..|:|        |:.
Human  1089 GEDGEKGEMGLPGIIGPLG------RSGQTGLPGPEGIVGIPGQRGRPGKKGDK--------GQI 1139

  Fly  1102 GPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGA 1166
            ||.||.|.:|.   .|:.|.:|.||.:|.:|..|..|..|..|.|||||..|..|.||.:     
Human  1140 GPTGEVGSRGP---PGKIGKSGPKGARGTRGAVGHLGLMGPDGEPGIPGYRGHQGQPGPS----- 1196

  Fly  1167 VGYPGDRGDKGEPG----LSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGD 1227
             |.||.:|:||.||    :.|.||.:||.||||.||..|.||.:|.:|..|.|||          
Human  1197 -GLPGPKGEKGYPGEDSTVLGPPGPRGEPGPVGDQGERGEPGAEGYKGHVGVPGL---------- 1250

  Fly  1228 KGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPG 1292
            :|:.|::|..||.|:|||:||.|.   .|::|::|.:|.||.||..||||.:|.:||:|..||  
Human  1251 RGATGQQGPPGEPGDQGEQGLKGE---RGSEGNKGKKGAPGPSGKPGIPGLQGLLGPKGIQGY-- 1310

  Fly  1293 VTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPG 1357
               .|..|:.|.||:      ||.|   |::||||:.|.||..||.|..||.|.||..||     
Human  1311 ---HGADGISGNPGK------IGPP---GKQGLPGIRGGPGRTGLAGAPGPPGVKGSSGL----- 1358

  Fly  1358 QPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLN 1422
                   ||:||::|..|.||..|:.|:.|..|.:|.:||   |||.|.|||.||.|:.|..||.
Human  1359 -------PGSPGIQGPKGEQGLPGQPGIQGKRGHRGAQGD---QGPCGDPGLKGQPGEYGVQGLT 1413

  Fly  1423 GNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGE 1487
                     |.:||.||||.:|..|..|:            .||||..|..|..||.      |.
Human  1414 ---------GFQGFPGPKGPEGDAGIVGI------------SGPKGPIGHRGNTGPL------GR 1451

  Fly  1488 RGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGEPGERGYEGAIGLIGQKGEPGAPAP----- 1547
            .|:||..|..|.:||:|..|||      ||:|.||:|            |..|.||||.|     
Human  1452 EGIIGPTGRTGPRGEKGFRGET------GPQGPRGQP------------GPPGPPGAPGPRKQMD 1498

  Fly  1548 --AALDYL--------------TGILITRHSQSETVPACSAGHTELWTGYSLLYVDGNDYAHNQD 1596
              ||:..|              |.:.:..||:            |::.  :|.|:....::....
Human  1499 INAAIQALIESNTALQMESYQNTEVTLIDHSE------------EIFK--TLNYLSNLLHSIKNP 1549

  Fly  1597 LGSPGSCVPRFSTLPVLSCGQNNVCNYASRNDKTFWLTTN-------------------AAIPMM 1642
            ||:..:  |......:|:|.|       ..:|..:|:..|                   ..:|.:
Human  1550 LGTRDN--PARICKDLLNCEQ-------KVSDGKYWIDPNLGCPSDAIEVFCNFSAGGQTCLPPV 1605

  Fly  1643 PVENIE-----IRQYISRCVVCEAPANVIAVH--------SQTIEVPDCPNGWEGLWIGYSFLMH 1694
            .|..:|     ::......:..|| .::|.:|        |.....|..|.|::| |.|..|.::
Human  1606 SVTKLEFGVGKVQMNFLHLLSSEA-THIITIHCLNTPRWTSTQTSGPGLPIGFKG-WNGQIFKVN 1668

  Fly  1695 TAVGNGGGGQALQSPGSCLEDFRATPFIECNGAKGTCHFYETMTSFWMYNLESSQ-PFERPQQQT 1758
            |          |..| ..|.|       :|....|:.|    ..:|..:..|.:| |....|:..
Human  1669 T----------LLEP-KVLSD-------DCKIQDGSWH----KATFLFHTQEPNQLPVIEVQKLP 1711

  Fly  1759 IKAGERQSHVSRCQVC 1774
            ....||:.::....||
Human  1712 HLKTERKYYIDSSSVC 1727

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Col4a1NP_723044.1 Collagen 104..161 CDD:189968
Collagen 322..380 CDD:189968 25/58 (43%)
Collagen 413..465 CDD:189968 23/55 (42%)
Collagen 499..561 CDD:189968 15/62 (24%)
Collagen 574..632 CDD:189968 25/58 (43%)
Collagen 657..714 CDD:189968 22/57 (39%)
Collagen 765..824 CDD:189968 18/59 (31%)
Collagen 854..911 CDD:189968 26/57 (46%)
Collagen 884..943 CDD:189968 27/59 (46%)
Collagen 923..982 CDD:189968 27/59 (46%)
Collagen 1028..1085 CDD:189968 27/57 (47%)
Collagen 1229..1287 CDD:189968 28/58 (48%)
Collagen 1318..1376 CDD:189968 24/58 (41%)
Collagen 1399..1458 CDD:189968 23/59 (39%)
Collagen 1477..1534 CDD:189968 20/57 (35%)
C4 1555..1662 CDD:128421 19/131 (15%)
C4 1663..1777 CDD:128421 27/122 (22%)
COL24A1XP_016856413.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126592
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.