DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Col4a1 and col-62

DIOPT Version :10

Sequence 1:NP_723044.1 Gene:Col4a1 / 33727 FlyBaseID:FBgn0000299 Length:1779 Species:Drosophila melanogaster
Sequence 2:NP_492091.1 Gene:col-62 / 172495 WormBaseID:WBGene00000638 Length:316 Species:Caenorhabditis elegans


Alignment Length:264 Identity:96/264 - (36%)
Similarity:111/264 - (42%) Gaps:81/264 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   452 GKKGEKGTAGLN-GPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGS--- 512
            |::.:|..:..| |.:.|..|.|.|||||..|.||..|.|        |.||.||.||:.|.   
 Worm    72 GRRRQKKQSQCNCGQQASNCPAGPPGPPGASGDKGHDGQP--------GQAGKPGQPGVAGPSHH 128

  Fly   513 ------KGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCS 571
                  |..:|..|.|||||.              ||.||..|.||.|.|.|..           
 Worm   129 QKQECIKCPQGLPGPAGAPGQ--------------PGPKGPNGNPGAPAQGGGQ----------- 168

  Fly   572 SCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATG 636
                ||         ||.||..|:.|.||:.|.|         |..|.||:.|:.|| ||||.:|
 Worm   169 ----GP---------PGPPGPAGSAGSPGQAGAP---------GNPGSPGKSGQRGR-GLPGPSG 210

  Fly   637 EPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGND 701
            .|               |.:|.|||||..|.....|..|.||..||.|:.|..|:.|..||||||
 Worm   211 AP---------------GSQGPPGAPGQPGSGNAPGPAGPPGPAGPNGQPGHPGQDGQPGAPGND 260

  Fly   702 GTPG 705
            ||||
 Worm   261 GTPG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Col4a1NP_723044.1 gly_rich_SclB <107..>361 CDD:468478
gly_rich_SclB <355..>642 CDD:468478 68/199 (34%)
gly_rich_SclB <543..820 CDD:468478 62/163 (38%)
gly_rich_SclB <727..>968 CDD:468478
gly_rich_SclB <969..>1218 CDD:468478
gly_rich_SclB <1186..>1420 CDD:468478
gly_rich_SclB <1321..>1547 CDD:468478
C4 1555..1662 CDD:128421
C4 1663..1777 CDD:128421
col-62NP_492091.1 Col_cuticle_N 6..57 CDD:198156
gly_rich_SclB <103..>266 CDD:468478 84/233 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.