DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Col4a1 and COL4A2

Sequence 1:NP_723044.1 Gene:Col4a1 FlyBaseID:FBgn0000299 Length:1779 Species:Drosophila melanogaster
Sequence 2:NP_001837.2 Gene:COL4A2 HGNCID:2203 Length:1712 Species:Homo sapiens

Alignment Length:1897 Identity:820/1898 (43%)
Similarity:966/1898 (51%) Gaps:328/1898 (17%)


  Fly    17 ALVGADAQFWKTAG--TAGSIQDSVKHYNRNEPKFPIDDSYDIVDSAGVARGDLP--PKNCTAGY 77
            |:.|...:.|...|  |.|.:..||                    .|||.:.|:|  .::|:   
Human     7 AVAGPALRRWLLLGTVTVGFLAQSV--------------------LAGVKKFDVPCGGRDCS--- 48

  Fly    78 AGCVPKCIAEKGNRGLPGPLGPTGLKGE---MGFPGMEGPSGDKGQKGDPGPYGQRGDKGER--- 136
            .||  :|..|||.||.|||:||.|..|.   .||||::|..||||::|.||..|.:||.|.|   
Human    49 GGC--QCYPEKGGRGQPGPVGPQGYNGPPGLQGFPGLQGRKGDKGERGAPGVTGPKGDVGARGVS 111

  Fly   137 GSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGE 201
            |.||..|..|.||..||.|.||..|.||..|..|..|.||.||.:|.|||:      |.||:|||
Human   112 GFPGADGIPGHPGQGGPRGRPGYDGCNGTQGDSGPQGPPGSEGFTGPPGPQ------GPKGQKGE 170

  Fly   202 P---AKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASC 263
            |   .||..|..:||.|||   |..|..||.|.||..|:.|..|..|..||.|..|.||::|...
Human   171 PYALPKEERDRYRGEPGEP---GLVGFQGPPGRPGHVGQMGPVGAPGRPGPPGPPGPKGQQGNRG 232

  Fly   264 YGPMKPGAPGIKGEKGEPA-SSFPVKPTHTVMGP----------RGDMGQKGEPGL--VGRKGEP 315
            .|..  |..|.||:.|:|. :..|....|.::.|          :|:.|.:||||:  :..|||.
Human   233 LGFY--GVKGEKGDVGQPGPNGIPSDTLHPIIAPTGVTFHPDQYKGEKGSEGEPGIRGISLKGEE 295

  Fly   316 GPEGDTGL---DGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGL------------ 365
            |..|..||   .|..||||.||..|.||..|..||.|..|.||:.|:||..||            
Human   296 GIMGFPGLRGYPGLSGEKGSPGQKGSRGLDGYQGPDGPRGPKGEAGDPGPPGLPAYSPHPSLAKG 360

  Fly   366 ----PGNPGQKGEPGRAGATGKPGLLGPPG-PPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDG 425
                ||.||.:||||..|..|.|||.|||| ..|.|....|.||..||:|::|.||...|.|  |
Human   361 ARGDPGFPGAQGEPGSQGEPGDPGLPGPPGLSIGDGDQRRGLPGEMGPKGFIGDPGIPALYG--G 423

  Fly   426 LPGPQGYNGQKGGAGLPGRPGNEG-PPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGL 489
            .|||.|..|..|..||||.||.:| ..|.||.||.||..|..||      ||..||:|.||||| 
Human   424 PPGPDGKRGPPGPPGLPGPPGPDGFLFGLKGAKGRAGFPGLPGS------PGARGPKGWKGDAG- 481

  Fly   490 PGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTP 554
               ..:.::||..|.|.|||.|.||..|..|..|..||.  |.||..|..|.||.||..|..|.|
Human   482 ---ECRCTEGDEAIKGLPGLPGPKGFAGINGEPGRKGDR--GDPGQHGLPGFPGLKGVPGNIGAP 541

  Fly   555 GQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGP 619
            |.|   |.|||      |.....||::|..|:||:||.      .|:.|.||..|.||..|..||
Human   542 GPK---GAKGD------SRTITTKGERGQPGVPGVPGM------KGDDGSPGRDGLDGFPGLPGP 591

  Fly   620 PGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKG 684
            ||:          |..|.||.|               ||||.||.||..|..|..|| |:||.||
Human   592 PGD----------GIKGPPGDP---------------GYPGIPGTKGTPGEMGPPGL-GLPGLKG 630

  Fly   685 EFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQ-----SIKGEPGFHGRDGAKGDKGSFGRSGE 744
            :.||.|:.||.|.||..|.||.|      |.|||     .:|...|        ||:      .|
Human   631 QRGFPGDAGLPGPPGFLGPPGPA------GTPGQIDCDTDVKRAVG--------GDR------QE 675

  Fly   745 KGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLN 809
            ..:||...         |.||.||..|.|||.|..|..|..|:.|..|..||:|.||..|..|..
Human   676 AIQPGCIG---------GPKGLPGLPGPPGPTGAKGLRGIPGFAGADGGPGPRGLPGDAGREGFP 731

  Fly   810 GPR---GEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGI---SRPGPMGPPGLNGLQGEK 868
            ||.   |.:|::||||:||..|..|..|:||.:|.||.||.||.   ::|||.|..|:.|..|.|
Human   732 GPPGFIGPRGSKGAVGLPGPDGSPGPIGLPGPDGPPGERGLPGEVLGAQPGPRGDAGVPGQPGLK 796

  Fly   869 GDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGV 933
            |..|..||.||.|:.|..|.||.:|..||||.||:||:.               ||||:.|..|.
Human   797 GLPGDRGPPGFRGSQGMPGMPGLKGQPGLPGPSGQPGLY---------------GPPGLHGFPGA 846

  Fly   934 RGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATG 998
            .|::|..|.||.||..|:|   ||||.||:         ||||   ||.|:.|:||.:||.|.||
Human   847 PGQEGPLGLPGIPGREGLP---GDRGDPGD---------TGAP---GPVGMKGLSGDRGDAGFTG 896

  Fly   999 LTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEK 1063
            ..|:.|..|.:|..|.||..|:|||:   |:||..|..||||.||..||||..|..|..|....|
Human   897 EQGHPGSPGFKGIDGMPGTPGLKGDR---GSPGMDGFQGMPGLKGRPGFPGSKGEAGFFGIPGLK 958

  Fly  1064 GQKGEPGPSGLRGDTGPAGTPG--WPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKG 1126
            |..||||..|.|||.||.|.|.  .||.|.:.|  ..|..||.|.||..|..||.|..||.|..|
Human   959 GLAGEPGFKGSRGDPGPPGPPPVILPGMKDIKG--EKGDEGPMGLKGYLGAKGIQGMPGIPGLSG 1021

  Fly  1127 EQGLQGVWGQ-PGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYP---GDRGDKGEPGLSGLPGL 1187
            ..||.|..|. .|.||.:|.|||||.|   |.||.||.||..|:|   |.|||||.||.:||.|.
Human  1022 IPGLPGRPGHIKGVKGDIGVPGIPGLP---GFPGVAGPPGITGFPGFIGSRGDKGAPGRAGLYGE 1083

  Fly  1188 KGETGPVGLQGFT----GAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGL 1248
            .|.||..|..|.|    |.||.|||||..|.|||                :|:.||||.:|:.|.
Human  1084 IGATGDFGDIGDTINLPGRPGLKGERGTTGIPGL----------------KGFFGEKGTEGDIGF 1132

  Fly  1249 TGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDI------GPRGEIGYPGVTIKGEKGLPGRPGR 1307
            .|..||.|.:|..||:|..|..||.|.||::|::      |.:|:.|:||.     .||||.||.
Human  1133 PGITGVTGVQGPPGLKGQTGFPGLTGPPGSQGELGRIGLPGGKGDDGWPGA-----PGLPGFPGL 1192

  Fly  1308 NGRQGLIGAPGLIGERGLPG--LAGEPGLVG-------------LPGPIGPAGSKGERGLAGS-- 1355
            .|.:||.|.||..|..|.||  :.|:||..|             ||||:|..|.||::|..|.  
Human  1193 RGIRGLHGLPGTKGFPGSPGSDIHGDPGFPGPPGERGDPGEANTLPGPVGVPGQKGDQGAPGERG 1257

  Fly  1356 -PGQPGQDGFP---------GAPGLKGDTGPQGFKGERGLNG------FEGQKGD---------- 1394
             ||.||..|||         ||||.||..|..|.||.||..|      ..|.|||          
Human  1258 PPGSPGLQGFPGITPPSNISGAPGDKGAPGIFGLKGYRGPPGPPGSAALPGSKGDTGNPGAPGTP 1322

  Fly  1395 -----KGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQ 1454
                 .||.|.||..|:.||.|:||..|..|..||.||.||.|:||..||||..|..|.||..|.
Human  1323 GTKGWAGDSGPQGRPGVFGLPGEKGPRGEQGFMGNTGPTGAVGDRGPKGPKGDPGFPGAPGTVGA 1387

  Fly  1455 KG----------EPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGER---GLI 1506
            .|          :||.:.|.|.:|.||.||..||:|.||.||.||..|..|.:|..|..   |..
Human  1388 PGIAGIPQKIAVQPGTVGPQGRRGPPGAPGEMGPQGPPGEPGFRGAPGKAGPQGRGGVSAVPGFR 1452

  Fly  1507 GETGNVGRPGPKGDRGEPGERGYEGAIGLIGQKGEPGAPAPAALDYLTGILITRHSQSETVPACS 1571
            |:.|.:|..||.|..|.|            |:.|.||.|.........|.|:.:|||::..|.|.
Human  1453 GDEGPIGHQGPIGQEGAP------------GRPGSPGLPGMPGRSVSIGYLLVKHSQTDQEPMCP 1505

  Fly  1572 AGHTELWTGYSLLYVDGNDYAHNQDLGSPGSCVPRFSTLPVLSCGQNNVCNYASRNDKTFWLTTN 1636
            .|..:||:||||||.:|.:.|||||||..|||:.||||:|.|.|...:||.|||||||::||:|.
Human  1506 VGMNKLWSGYSLLYFEGQEKAHNQDLGLAGSCLARFSTMPFLYCNPGDVCYYASRNDKSYWLSTT 1570

  Fly  1637 AAIPMMPVENIEIRQYISRCVVCEAPANVIAVHSQTIEVPDCPNGWEGLWIGYSFLMHTAVGNGG 1701
            |.:|||||...||:.|||||.||||||..||||||.:.:|.||.||..||||||||||||.|:.|
Human  1571 APLPMMPVAEDEIKPYISRCSVCEAPAIAIAVHSQDVSIPHCPAGWRSLWIGYSFLMHTAAGDEG 1635

  Fly  1702 GGQALQSPGSCLEDFRATPFIECNGAKGTCHFYETMTSFWMYNLESSQPFE-RPQQQTIKAGERQ 1765
            |||:|.|||||||||||||||||||.:||||:|....|||:..: ..|.|: .|...|:|||..:
Human  1636 GGQSLVSPGSCLEDFRATPFIECNGGRGTCHYYANKYSFWLTTI-PEQSFQGSPSADTLKAGLIR 1699

  Fly  1766 SHVSRCQVCMKN 1777
            :|:|||||||||
Human  1700 THISRCQVCMKN 1711

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Col4a1NP_723044.1 Collagen 104..161 CDD:189968 30/63 (48%)
Collagen 322..380 CDD:189968 33/77 (43%)
Collagen 413..465 CDD:189968 27/53 (51%)
Collagen 499..561 CDD:189968 29/62 (47%)
Collagen 574..632 CDD:189968 20/58 (34%)
Collagen 657..714 CDD:189968 29/57 (51%)
Collagen 765..824 CDD:189968 28/62 (45%)
Collagen 854..911 CDD:189968 27/57 (47%)
Collagen 884..943 CDD:189968 22/59 (37%)
Collagen 923..982 CDD:189968 27/59 (46%)
Collagen 1028..1085 CDD:189968 31/57 (54%)
Collagen 1229..1287 CDD:189968 24/64 (38%)
Collagen 1318..1376 CDD:189968 33/85 (39%)
Collagen 1399..1458 CDD:189968 30/69 (43%)
Collagen 1477..1534 CDD:189968 22/60 (37%)
C4 1555..1662 CDD:128421 63/107 (59%)
C4 1663..1777 CDD:128421 73/115 (63%)
COL4A2NP_001837.2 Collagen 67..121 CDD:189968 25/54 (46%)
Triple-helical region 184..1484 600/1460 (41%)
Collagen 293..346 CDD:189968 26/53 (49%)
Collagen 493..548 CDD:189968 28/60 (47%)
Collagen 791..849 CDD:189968 30/73 (41%)
Collagen 821..880 CDD:189968 36/89 (40%)
Collagen 857..916 CDD:189968 33/74 (45%)
Collagen 896..950 CDD:189968 27/57 (47%)
Collagen 1033..1088 CDD:189968 32/58 (55%)
Collagen 1107..1165 CDD:189968 30/74 (41%)
Collagen 1155..1212 CDD:189968 26/62 (42%)
Collagen 1341..1394 CDD:189968 26/53 (49%)
C4 1490..1594 CDD:279721 60/104 (58%)
C4 1598..1709 CDD:279721 70/112 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BAFZ
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H1390
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D41315at33208
OrthoFinder 1 1.000 FOG0000150
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126592
Panther 1 1.100 O PTHR24023
Phylome 1 0.910 0.714 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2460
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.