DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Col4a1 and COL2A1

Sequence 1:NP_723044.1 Gene:Col4a1 FlyBaseID:FBgn0000299 Length:1779 Species:Drosophila melanogaster
Sequence 2:XP_016874317.1 Gene:COL2A1 HGNCID:2200 Length:1535 Species:Homo sapiens

Alignment Length:1729 Identity:624/1730 (36%)
Similarity:742/1730 (43%) Gaps:412/1730 (24%)


  Fly     6 KRLLYAAVIAGALVGADAQFWKTAGTAGSIQDSVKHYNRNEPKFPIDDSYDIVDSAGVARGDL-- 68
            |.|:...::..|::....|..:.||:.  :||. :.||..:...|......:.|:..|...|:  
Human    55 KTLVLLTLLVAAVLRCQGQDVQEAGSC--VQDG-QRYNDKDVWKPEPCRICVCDTGTVLCDDIIC 116

  Fly    69 -PPKNCTA---GYAGCVPKCIAEKGNRGLPGPLGPTGLKGEMG----FPGMEGPSGDKGQKGDPG 125
             ..|:|.:   .:..|.|.|..:........| ||.|.|||.|    ..|.:||.|.:|..|:.|
Human   117 EDVKDCLSPEIPFGECCPICPTDLATASGWQP-GPKGQKGEPGDIKDIVGPKGPPGPQGPAGEQG 180

  Fly   126 PYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYA 190
            |.|.||||||:|:||..|:.|.||..|..|.||.|                     |.|||.|..
Human   181 PRGDRGDKGEKGAPGPRGRDGEPGTPGNPGPPGPP---------------------GPPGPPGLG 224

  Fly   191 GQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGL 255
            |...::...|...|..|               |.|...||..|..|.||..||.||.||:|..|.
Human   225 GNFAAQMAGGFDEKAGG---------------AQLGVMQGPMGPMGPRGPPGPAGAPGPQGFQGN 274

  Fly   256 KGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGD 320
            .||          ||.||:.|.                |||||..|..|:||..|..|:||..|:
Human   275 PGE----------PGEPGVSGP----------------MGPRGPPGPPGKPGDDGEAGKPGKAGE 313

  Fly   321 TGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPG 385
            .|..|.:|.:|.||.||..|.:|:.|.||..|.||:.|.||:.|..|:||:.|.||..|..|.||
Human   314 RGPPGPQGARGFPGTPGLPGVKGHRGYPGLDGAKGEAGAPGVKGESGSPGENGSPGPMGPRGLPG 378

  Fly   386 LLGPPGPPG--GGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNE 448
            ..|..||.|  |.||..|.|||.||                  |||.   |..||.|.|      
Human   379 ERGRTGPAGAAGARGNDGQPGPAGP------------------PGPV---GPAGGPGFP------ 416

  Fly   449 GPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGY-GIQGSKGDAGIPGYPGLKGS 512
            |.||.|||.|..|..||:|:.||.|.||.||..|..|.:|.||. ||.|:||.||.||..|..|.
Human   417 GAPGAKGEAGPTGARGPEGAQGPRGEPGTPGSPGPAGASGNPGTDGIPGAKGSAGAPGIAGAPGF 481

  Fly   513 KGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGP 577
            .|.|              |.||..||.|..|.||..|.||..|.||:.|.||:.|........||
Human   482 PGPR--------------GPPGPQGATGPLGPKGQTGEPGIAGFKGEQGPKGEPGPAGPQGAPGP 532

  Fly   578 KGDKGTSGLPGIPGKDGARGPPGERGYPGER---GHDGINGQTGPPGEKGEDGRTGLPGATGEPG 639
            .|::|..|..|.||..|..|||||||.||.|   |.||:.|..|.|||:|..|..|..||.|:||
Human   533 AGEEGKRGARGEPGGVGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLAGPKGANGDPG 597

  Fly   640 KPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTP 704
            :|               |.||.|||:|:      .|.||..||:|:.      |.|||||.||.|
Human   598 RP---------------GEPGLPGARGL------TGRPGDAGPQGKV------GPSGAPGEDGRP 635

  Fly   705 GRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQ 769
            |..|..|        .:|:||..|..|.||..|..|::||||.||:..|       :|..|:.|:
Human   636 GPPGPQG--------ARGQPGVMGFPGPKGANGEPGKAGEKGLPGAPGL-------RGLPGKDGE 685

  Fly   770 TGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRG 834
            ||..||||..|..||||..|..|.:|.||.||..||.|..|..|::|..|..|.||..|..|.||
Human   686 TGAAGPPGPAGPAGERGEQGAPGPSGFQGLPGPPGPPGEGGKPGDQGVPGEAGAPGLVGPRGERG 750

  Fly   835 IPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPG 899
            .||..|.||.:|     ..||.|.||..|..|.||..||.||.|..|..|..|.||:||.||:.|
Human   751 FPGERGSPGAQG-----LQGPRGLPGTPGTDGPKGASGPAGPPGAQGPPGLQGMPGERGAAGIAG 810

  Fly   900 VSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGND 964
            ..|..|.||||            ||.|.||.||.||..|..|.||.   .|..|.||:.|.|   
Human   811 PKGDRGDVGEK------------GPEGAPGKDGGRGLTGPIGPPGP---AGANGEKGEVGPP--- 857

  Fly   965 GPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGA 1029
            ||.|.||..||||:||..|.|                  ||.|..|||||.|..|.||:||.|  
Human   858 GPAGSAGARGAPGERGETGPP------------------GPAGFAGPPGADGQPGAKGEQGEA-- 902

  Fly  1030 PGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPG 1094
                      |:||:.|.||..||.|.||   .:|..|..||.|.||..||      ||..|.||
Human   903 ----------GQKGDAGAPGPQGPSGAPG---PQGPTGVTGPKGARGAQGP------PGATGFPG 948

  Fly  1095 LAVHGRAGPPGEKGD---QGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDG 1156
            .|  ||.||||..|:   .|..|..|:||..|.:|:.|..|..|:||.:|..|.||..|.||.||
Human   949 AA--GRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGRAGEPGLQGPAGPPGEKGEPGDDG 1011

  Fly  1157 LPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATV 1221
            ..||.|.||..|..|.|      |:.||||.:||      :||.|.|||.||.|.:|.|      
Human  1012 PSGAEGPPGPQGLAGQR------GIVGLPGQRGE------RGFPGLPGPSGEPGKQGAP------ 1058

  Fly  1222 PDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRG 1286
                   |:.|:|   |..|..|..|||||||..|.:|..|..||||..|..|:   |||.|..|
Human  1059 -------GASGDR---GPPGPVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGV---KGDRGETG 1110

  Fly  1287 EIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERG 1351
            .:|.||.        ||.||.                              |||.||.|.:|:||
Human  1111 AVGAPGA--------PGPPGS------------------------------PGPAGPTGKQGDRG 1137

  Fly  1352 LAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDT 1416
            .||:.|..|..|..||.|::|..||:|.|||.   |..|::|.||.||..|..||||..|..|| 
Human  1138 EAGAQGPMGPSGPAGARGIQGPQGPRGDKGEA---GEPGERGLKGHRGFTGLQGLPGPPGPSGD- 1198

  Fly  1417 GYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGE 1481
                 .|..||.|..|.||..||.|..|:||..|:||..|      ||||:|..|:.|..||.|.
Human  1199 -----QGASGPAGPSGPRGPPGPVGPSGKDGANGIPGPIG------PPGPRGRSGETGPAGPPGN 1252

  Fly  1482 PGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGEPG-ERGYEGAIGLIGQKGEPGAP 1545
            ||.||.                           |||.|    || :......:|       |...
Human  1253 PGPPGP---------------------------PGPPG----PGIDMSAFAGLG-------PREK 1279

  Fly  1546 APAALDYL-----TGILITRHSQSETVPACSAGHTELWTGYSLLYVDGNDYAHNQDLGSPGSCVP 1605
            .|..|.|:     .|.|  |...:|                    ||....:.|..:.|..|  |
Human  1280 GPDPLQYMRADQAAGGL--RQHDAE--------------------VDATLKSLNNQIESIRS--P 1320

  Fly  1606 RFSTL-PVLSCGQNNVCNYASRNDKTFWLTTNAAIPMMPVENIEIRQYISRCVVCEAPANVIAVH 1669
            ..|.. |..:|....:| :.......:|:..|....:..::           |.|........|:
Human  1321 EGSRKNPARTCRDLKLC-HPEWKSGDYWIDPNQGCTLDAMK-----------VFCNMETGETCVY 1373

  Fly  1670 SQTIEVPDCPNGWEG-------LWIGYSFLMHTAVGNGG 1701
            .....||. .|.|..       :|.|.:.       |||
Human  1374 PNPANVPK-KNWWSSKSKEKKHIWFGETI-------NGG 1404

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Col4a1NP_723044.1 Collagen 104..161 CDD:189968 30/61 (49%)
Collagen 322..380 CDD:189968 27/58 (47%)
Collagen 413..465 CDD:189968 17/52 (33%)
Collagen 499..561 CDD:189968 24/62 (39%)
Collagen 574..632 CDD:189968 30/61 (49%)
Collagen 657..714 CDD:189968 25/57 (44%)
Collagen 765..824 CDD:189968 28/59 (47%)
Collagen 854..911 CDD:189968 30/57 (53%)
Collagen 884..943 CDD:189968 26/59 (44%)
Collagen 923..982 CDD:189968 30/59 (51%)
Collagen 1028..1085 CDD:189968 20/57 (35%)
Collagen 1229..1287 CDD:189968 27/58 (47%)
Collagen 1318..1376 CDD:189968 19/58 (33%)
Collagen 1399..1458 CDD:189968 26/59 (44%)
Collagen 1477..1534 CDD:189968 13/58 (22%)
C4 1555..1662 CDD:128421 18/108 (17%)
C4 1663..1777 CDD:128421 10/47 (21%)
COL2A1XP_016874317.1 VWC 81..136 CDD:278520 12/58 (21%)
Collagen 306..365 CDD:189968 27/59 (46%)
Collagen 422..476 CDD:189968 29/54 (54%)
Collagen 516..589 CDD:189968 34/73 (47%)
Collagen 561..619 CDD:189968 30/79 (38%)
Collagen 594..665 CDD:189968 38/106 (36%)
Collagen 732..780 CDD:189968 23/53 (43%)
Collagen 849..908 CDD:189968 36/92 (39%)
Collagen 885..943 CDD:189968 34/79 (43%)
Collagen 969..1021 CDD:189968 25/52 (48%)
Collagen 996..1054 CDD:189968 33/70 (47%)
Collagen 1137..>1183 CDD:189968 23/49 (47%)
COLFI 1302..1534 CDD:279718 25/146 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BAFZ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126592
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.