DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scox and sco-1

DIOPT Version :8

Sequence 1:NP_608884.1 Gene:Scox / 33711 FlyBaseID:FBgn0262467 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_494755.1 Gene:sco-1 / 173763 WormBaseID:WBGene00015297 Length:312 Species:Caenorhabditis elegans

Alignment Length:240 Identity:111/241 (46%)
Similarity:155/241 (64%) Gaps:18/241 (7%)


  Fly    13 RRWAQQPAIRHYAAPADSTKGKGPISWRSLAVIGALGAGG--VGFMLYVKSEKDEARMKERQRQL 75
            |:.|:|.|.:..:.          .:|::  |:|....||  :..:.|:|..:.:.|.|.|::..
 Worm    80 RKQAEQEAFQRSSI----------FNWKT--VLGTFAVGGTCLAALFYIKKIRLDEREKHRKQTA 132

  Fly    76 GKAAIGGSWELVDSQGAVRKSEDFLGKWLLIYFGFTHCPDICPDELEKMAAVVDEVE-KSPQTPA 139
            |||.|||.|||:::.|.:..|::..|.|||:|||||:||||||||:|||..||:.:| |...||.
 Worm   133 GKARIGGEWELMNTDGKMEGSQELRGNWLLMYFGFTNCPDICPDEIEKMVKVVEIIEAKKDATPI 197

  Fly   140 VQPIFITVDPERDSKEVVAKYVKEFSPKLLGLTGTVEQIRKVCKAFRVYFSAGPR--DEDNDYIV 202
            | |:||:|||||||...|.:|..|||.||.|.|||.||:.||.|.||||.|.|||  .:::||||
 Worm   198 V-PVFISVDPERDSVARVKEYCSEFSNKLRGFTGTTEQVNKVAKTFRVYHSQGPRTNKQEDDYIV 261

  Fly   203 DHTIIMYLVNPDGEFVDYYGQNRDKDQCVASILVNIAKWNSMNKK 247
            |||:||||::|.|:|.|||||||..::....|.:.:.|:.:.|:|
 Worm   262 DHTVIMYLIDPSGQFHDYYGQNRKAEEIANVIEMKVLKYQAQNRK 306

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ScoxNP_608884.1 AhpC-TSA 75..203 CDD:278975 76/131 (58%)
SCO 80..222 CDD:239266 86/145 (59%)
sco-1NP_494755.1 SCO 137..281 CDD:239266 86/145 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1999
Hieranoid 1 1.000
Homologene 1 1.000 H3374
Inparanoid 1 1.050 218 1.000 Inparanoid score I2268
Isobase 1 0.950 0 Normalized mean entropy S1273
OMA 1 1.010
OrthoDB 1 1.010 D1462537at2759
OrthoFinder 1 1.000 FOG0001844
OrthoInspector 1 1.000 T476558
orthoMCL 1 0.900 OOG5_127363
Panther 1 1.100 LDO PTHR12151
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1293
TreeFam 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.