DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: eIF3i and TIF34

Sequence 1:NP_523478.1 Gene:eIF3i FlyBaseID:FBgn0015834 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_013866.1 Gene:TIF34 SGDID:S000004754 Length:347 Species:Saccharomyces cerevisiae

Alignment Length:328 Identity:148/329 (45%)
Similarity:211/329 (64%) Gaps:6/329 (2%)


  Fly     1 MRPLMLQGHERSITQIKYNREGDLLFSCSKDQKPNVWYSLNGERLGTYDGHQGAVWCLDVDWESR 65
            |:.:.|.||||.:||:|||:|||||||||||...:||||||||||||.|||.|.:|.:|||..::
Yeast     1 MKAIKLTGHERPLTQVKYNKEGDLLFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSIDVDCFTK 65

  Fly    66 KLITGAGDMTAKIWDVEYGTVIASIPTKSSVRTSNFSFSGNQAAYSTDKAMGQ--SCELFLIDVR 128
            ..:||:.|.:.|:|||..|..:|:..:...|:...||..||......|..|..  |..::.|:..
Yeast    66 YCVTGSADYSIKLWDVSNGQCVATWKSPVPVKRVEFSPCGNYFLAILDNVMKNPGSINIYEIERD 130

  Fly   129 NADSSLSE--QEPTLRIPMTE--SKITSMLWGPLDETIITGHDNGNIAIWDIRKGQKVVDSGTDH 189
            :|...|::  :||..:|...|  ...|...|....:.||.||.:|.|:.:|:....:.|||...|
Yeast   131 SATHELTKVSEEPIHKIITHEGLDAATVAGWSTKGKYIIAGHKDGKISKYDVSNNYEYVDSIDLH 195

  Fly   190 SAGINDMQLSKDGTMFVTASKDTTAKLFDSESLMCLKTYKTERPVNSAAISPIMDHVVLGGGQDA 254
            ...|:|||.|.|.|.|:|:|:||.:.|.|..:|..||.|:|:.|:|:|.|:|:.:.::|||||:|
Yeast   196 EKSISDMQFSPDLTYFITSSRDTNSFLVDVSTLQVLKKYETDCPLNTAVITPLKEFIILGGGQEA 260

  Fly   255 MEVTTTSTKAGKFDSRFFHLIYEEEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQTFDST 319
            .:|||||...|||::||:|.|:|||..|::|||||:|::|..|.|.||||||||||:|:..|:.:
Yeast   261 KDVTTTSANEGKFEARFYHKIFEEEIGRVQGHFGPLNTVAISPQGTSYASGGEDGFIRLHHFEKS 325

  Fly   320 YFE 322
            ||:
Yeast   326 YFD 328

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eIF3iNP_523478.1 WD40 6..313 CDD:295369 144/313 (46%)
WD40 <9..313 CDD:225201 142/310 (46%)
WD40 repeat 13..50 CDD:293791 29/37 (78%)
WD40 repeat 56..91 CDD:293791 13/35 (37%)
WD40 repeat 96..142 CDD:293791 13/50 (26%)
WD40 repeat 151..186 CDD:293791 12/35 (34%)
WD40 repeat 193..228 CDD:293791 17/35 (49%)
WD40 repeat 234..284 CDD:293791 26/50 (52%)
WD40 repeat 290..313 CDD:293791 15/23 (65%)
TIF34NP_013866.1 WD40 6..319 CDD:330360 144/313 (46%)
WD40 repeat 13..49 CDD:293791 28/36 (78%)
WD40 repeat 56..91 CDD:293791 13/35 (37%)
WD40 repeat 96..148 CDD:293791 14/52 (27%)
WD40 repeat 156..193 CDD:293791 12/37 (32%)
WD40 repeat 240..290 CDD:293791 26/50 (52%)
WD40 repeat 297..319 CDD:293791 15/22 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0643
Hieranoid 1 1.000
Homologene 1 1.000 H2786
Inparanoid 1 1.050 295 1.000 Inparanoid score I511
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004210
OrthoInspector 1 1.000 T1135594
orthoMCL 1 0.900 OOG5_127718
Panther 1 1.100 LDO PTHR19877
Phylome 1 0.910 0.983 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R384
TreeFam 1 0.960
1211.860

Return to query results.
Submit another query.