DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: eIF3i and eif3i

Sequence 1:NP_523478.1 Gene:eIF3i FlyBaseID:FBgn0015834 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001015781.1 Gene:eif3i XenbaseID:XB-GENE-974377 Length:325 Species:Xenopus tropicalis

Alignment Length:326 Identity:202/327 (62%)
Similarity:257/327 (79%) Gaps:2/327 (1%)


  Fly     1 MRPLMLQGHERSITQIKYNREGDLLFSCSKDQKPNVWYSLNGERLGTYDGHQGAVWCLDVDWESR 65
            |||::|||||||||||||||:|||||:.:||...|||||:||||||||.||.|||||:||||::|
 Frog     1 MRPILLQGHERSITQIKYNRDGDLLFTVAKDPVVNVWYSVNGERLGTYSGHTGAVWCVDVDWDTR 65

  Fly    66 KLITGAGDMTAKIWDVEYGTVIASIPTKSSVRTSNFSFSGNQAAYSTDKAMGQSCELFLIDVRNA 130
            .:::|:.|.:.::||.|.|..:|.:.|.|:|||..|.|.||...:||||.||..|.:..||:|: 
 Frog    66 HVLSGSADNSCRLWDCETGKQLALLETNSAVRTCGFDFGGNIIMFSTDKQMGYQCFVSFIDLRD- 129

  Fly   131 DSSLSEQEPTLRIPMTESKITSMLWGPLDETIITGHDNGNIAIWDIRKGQKVVDSGTDHSAGIND 195
            .:.:.:.||.::||.:||||||.:||||.|.||.||:||.:..:..:.|: :|:|..:||..|||
 Frog   130 PTQIEDNEPYMKIPCSESKITSAVWGPLGENIIAGHENGELNQYSAKSGE-IVNSIKEHSKQIND 193

  Fly   196 MQLSKDGTMFVTASKDTTAKLFDSESLMCLKTYKTERPVNSAAISPIMDHVVLGGGQDAMEVTTT 260
            :|.|:|.|||||||||.|:|||||.||...||::|||||||||||||.|||||||||:||:||||
 Frog   194 IQTSRDMTMFVTASKDCTSKLFDSTSLEHQKTFRTERPVNSAAISPIYDHVVLGGGQEAMDVTTT 258

  Fly   261 STKAGKFDSRFFHLIYEEEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQTFDSTYFENIF 325
            ||:.|||::||||:.:||||.|:|||||||||||||||||||:||||||:||:..||..||:..|
 Frog   259 STRIGKFEARFFHVAFEEEFGRVKGHFGPINSLAFHPDGKSYSSGGEDGYVRIHYFDPQYFDFEF 323

  Fly   326 E 326
            |
 Frog   324 E 324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eIF3iNP_523478.1 WD40 6..313 CDD:295369 193/307 (63%)
WD40 <9..313 CDD:225201 190/304 (63%)
WD40 repeat 13..50 CDD:293791 28/37 (76%)
WD40 repeat 56..91 CDD:293791 14/35 (40%)
WD40 repeat 96..142 CDD:293791 19/46 (41%)
WD40 repeat 151..186 CDD:293791 16/35 (46%)
WD40 repeat 193..228 CDD:293791 25/35 (71%)
WD40 repeat 234..284 CDD:293791 38/50 (76%)
WD40 repeat 290..313 CDD:293791 21/23 (91%)
eif3iNP_001015781.1 WD40 6..311 CDD:330360 193/307 (63%)
WD 1 8..47 31/39 (79%)
WD40 repeat 14..50 CDD:293791 27/36 (75%)
WD 2 50..89 19/39 (49%)
WD40 repeat 55..91 CDD:293791 15/36 (42%)
WD 3 144..183 19/40 (48%)
WD40 repeat 150..185 CDD:293791 16/36 (44%)
WD 4 186..225 26/39 (67%)
WD40 repeat 191..226 CDD:293791 25/35 (71%)
WD40 repeat 232..272 CDD:293791 33/40 (83%)
WD 5 283..324 31/41 (76%)
WD40 repeat 288..311 CDD:293791 21/23 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C153649622
eggNOG 1 0.900 E1_KOG0643
Hieranoid 1 1.000
Homologene 1 1.000 H2786
Inparanoid 1 1.050 425 1.000 Inparanoid score I1626
OMA 1 1.010
OrthoDB 1 1.010 D458807at33208
OrthoFinder 1 1.000 FOG0004210
OrthoInspector 1 1.000 T1058535
Phylome 1 0.910 0.947 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R384
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.