DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and zgc:100868

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_005164187.1 Gene:zgc:100868 / 554458 ZFINID:ZDB-GENE-040801-33 Length:654 Species:Danio rerio


Alignment Length:273 Identity:86/273 - (31%)
Similarity:135/273 - (49%) Gaps:32/273 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFLAILALAVASASAFDEKVFVKDLPKATKIEGRITNGYAAPEGKAPYTVGLGFSGGWWCGGS 65
            ||:.:..:||.:|..:..|.::   |:.....:..||..|..||.|..|:.|.|...|..:||||
Zfish     4 MKIHIVGVALTIALLTGCDAQL---DVCGTAPLNSRIVGGQNAPVGAWPWQVSLQRDGSHFCGGS 65

  Fly    66 IIAHDWVLTAEHCIGDAAS--VIVYFG----ATWRTNAQFTHTVGNGNFIKHSN-------ADIA 117
            :|.:.|:|||.||..:.::  ::||.|    |::.:   ::.:....|.|||.|       .||.
Zfish    66 LINNQWILTAAHCFPNPSTTGLLVYLGLQKLASFES---YSMSSAVSNIIKHPNYNSDTEDNDIT 127

  Fly   118 LIRIPH-VDFWHMVNKVELPSYNDRYNNYNEWWAVACGWGGTYDG--SPLPDWLQCVDLQIVHNE 179
            |:::.. |.|.:.:..:.|.:.:..:.|....|..  |||.|..|  .|.|..||.|.:.||.|.
Zfish   128 LLQLASTVSFSNYIRPICLAASDSTFFNGTLVWIT--GWGNTATGVSLPSPGTLQEVQVPIVGNR 190

  Fly   180 ECGWTYG--SVGDNVICTRTVD-GKSICGGDSGGPLVTHDGSKLV--GVSNFVSSNGC-QSGAPA 238
            :|...||  .:.||::|...:. ||..|.||||||:|:..||..:  |:.:|  ..|| |...|.
Zfish   191 KCNCLYGVSKITDNMVCAGLLQGGKDSCQGDSGGPMVSKQGSVWIQSGIVSF--GTGCAQPNFPG 253

  Fly   239 GFQRVTYHLDWIR 251
            .:.||:.:..||:
Zfish   254 VYTRVSKYQSWIQ 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 77/235 (33%)
Tryp_SPc 37..253 CDD:238113 78/237 (33%)
zgc:100868XP_005164187.1 Tryp_SPc 36..265 CDD:214473 77/235 (33%)
Tryp_SPc 37..267 CDD:238113 78/237 (33%)
Tryp_SPc 331..509 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.