DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and TMPRSS7

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001382436.1 Gene:TMPRSS7 / 344805 HGNCID:30846 Length:843 Species:Homo sapiens


Alignment Length:263 Identity:70/263 - (26%)
Similarity:115/263 - (43%) Gaps:43/263 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 DLPKATKIEG-----------RITNGYAAPEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHC- 78
            |.|..:..||           ||..|....||..|:.|.|.|.|..:||.|:|:.:|:|:|.|| 
Human   584 DCPDGSDEEGCTCSRSSSALHRIIGGTDTLEGGWPWQVSLHFVGSAYCGASVISREWLLSAAHCF 648

  Fly    79 ----IGDAASVIVYFGATWRTNAQFTHTVGNGNFIKHSNA-----DIALIRIPHVDFW-----HM 129
                :.|......:.|...:.||:|...|......::.|:     ||||:::...  |     .:
Human   649 HGNRLSDPTPWTAHLGMYVQGNAKFVSPVRRIVVHEYYNSQTFDYDIALLQLSIA--WPETLKQL 711

  Fly   130 VNKVELPSYNDRYNNYNEWWAVACGWGGTYD----GSPLPDWLQCVDLQIVHNEECGWTYGSVGD 190
            :..:.:|....|..:..:.|..  |||..::    ||.:   ||..:::::....|..|||.:..
Human   712 IQPICIPPTGQRVRSGEKCWVT--GWGRRHEADNKGSLV---LQQAEVELIDQTLCVSTYGIITS 771

  Fly   191 NVICTRTVDGK-SICGGDSGGPLVTH---DGS-KLVGVSNFVSSNGCQSGAPAGFQRVTYHLDWI 250
            .::|...:.|| ..|.|||||||...   ||. .|.|:.::...:| :...|..:.||:..:.||
Human   772 RMLCAGIMSGKRDACKGDSGGPLSCRRKSDGKWILTGIVSWGHGSG-RPNFPGVYTRVSNFVPWI 835

  Fly   251 RDH 253
            ..:
Human   836 HKY 838

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 64/237 (27%)
Tryp_SPc 37..253 CDD:238113 65/239 (27%)
TMPRSS7NP_001382436.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..67
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.