DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and CG31954

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster


Alignment Length:249 Identity:80/249 - (32%)
Similarity:124/249 - (49%) Gaps:41/249 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KIEGRITNGYAAPEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHC-IGDAA---------SVI 86
            :::|||..|:......||:.|.|..| ...||||||:.:|:|||.|| .|..|         |..
  Fly    46 RLDGRIVGGHRINITDAPHQVSLQTS-SHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEF 109

  Fly    87 VYFGATWRT-----NAQFTHTVGNGNFIKHSNADIALIRIPH-VDFWHMVNKVELPSYNDRYNNY 145
            ...|...|.     :|||.:|        :.:.|.:|:::.| :.|......|:||....:|.: 
  Fly   110 ARSGQLLRVQKIVQHAQFNYT--------NVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMD- 165

  Fly   146 NEWWAVAC---GWGGTYDGSPLPDWLQCVDLQIVHNEECG---WTYGSVGDNVICTRTVD-GKSI 203
                ..||   |||.|.:.....:||:.|::.:|:.|.|.   ..||.|.:.:||...:: ||..
  Fly   166 ----GEACFVSGWGNTQNLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDA 226

  Fly   204 CGGDSGGPLVTHDGSKLVGVSNFVSSNGC-QSGAPAGFQRVTYHLDWIRDHTGI 256
            |.||||||:|:..| :||||.::  ..|| :...|..:.||::..|||::|:|:
  Fly   227 CQGDSGGPMVSESG-ELVGVVSW--GYGCAKPDYPGVYSRVSFARDWIKEHSGV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 75/237 (32%)
Tryp_SPc 37..253 CDD:238113 76/239 (32%)
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 75/237 (32%)
Tryp_SPc 51..274 CDD:238113 76/239 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.