DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and Klk1c10

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001128645.1 Gene:Klk1c10 / 292858 RGDID:1561403 Length:259 Species:Rattus norvegicus


Alignment Length:284 Identity:76/284 - (26%)
Similarity:121/284 - (42%) Gaps:63/284 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFLAILALAVASASAFDEKVFVKDLPKATKIEGRITNGYAAPEGKAPYTVGLGFSGGWWCGGS 65
            |...:..|||::....|            |...:.||..||...:...|:.|.:  ...:.|||.
  Rat     1 MWFLILFLALSLGGIDA------------APPGQSRIVGGYKCEKNSQPWQVAI--INEYLCGGV 51

  Fly    66 IIAHDWVLTAEHCIGDAASVIVYFGATWRTN-------AQF------------------THTVGN 105
            :|...||:||.||..:...|::     .|.|       ||:                  .||...
  Rat    52 LIDPSWVITAAHCYSNYYHVLL-----GRNNLFEDEPFAQYRFVNQSFPHPDYKPFLMRNHTRQR 111

  Fly   106 GNFIKHSNADIALIRIPH-VDFWHMVNKVELPSYNDRYNNYNEWWAVACGWGGTYDGSP----LP 165
            |:  .:|| |:.|:.:.. .|....|..::||:...:..:    ..:|.|||.|   .|    ||
  Rat   112 GD--DYSN-DLMLLHLSEPADITDGVKVIDLPTEEPKVGS----TCLASGWGST---KPLNWELP 166

  Fly   166 DWLQCVDLQIVHNEECGWTY-GSVGDNVICTRTVDG-KSICGGDSGGPLVTHDGSKLVGVSNFVS 228
            |.||||::.::.||:|...| ..|.|.::|...:|| |..|.|||||||:. || .|.|::::.:
  Rat   167 DDLQCVNIHLLSNEKCIEAYEQKVTDLMLCAGEMDGRKDTCKGDSGGPLIC-DG-VLQGITSWGN 229

  Fly   229 SNGCQSGAPAGFQRVTYHLDWIRD 252
            ....:...|..:.::.....||::
  Rat   230 VPCAEPYNPGVYTKLIKFTSWIKE 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 68/245 (28%)
Tryp_SPc 37..253 CDD:238113 69/248 (28%)
Klk1c10NP_001128645.1 Tryp_SPc 24..251 CDD:214473 68/245 (28%)
Tryp_SPc 25..254 CDD:238113 69/248 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.