DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and CG30090

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:291 Identity:83/291 - (28%)
Similarity:117/291 - (40%) Gaps:70/291 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AILALAVASASAFDEKVFVKDLPK----ATKIEGRITNGYAAPEGKAPYTVGLGFSGGWWCGGSI 66
            ||.|||:....:.....:::  |:    |..|..:|..|..|.....|:...:..|....|||::
  Fly     7 AITALAIGVLCSLGNGEYLE--PRCGLTANTIAFKIIGGRDAIINSNPWMAYIHSSVKLICGGTL 69

  Fly    67 IAHDWVLTAEHCIGDAASVIVYFG-----ATWRTNAQF------THTVG----NGNF--IKHSNA 114
            |...:||||.||:.:.::|.|..|     ||...|::.      .|.|.    :|.|  ||:.| 
  Fly    70 ITQRFVLTAAHCVNEGSAVKVRLGEYDDTATEDCNSKICIPRAEEHDVDMAFRHGKFSEIKNLN- 133

  Fly   115 DIALIRI-------PHV---------DFWHMVNKVELPSYNDRYNNYNEWWAVACGWGGTYD--- 160
            ||||:|:       .|:         ....:|:.:|              |.||.|||.|..   
  Fly   134 DIALLRLAKFVTFKAHISPICIILGTSKRELVDSIE--------------WFVATGWGETRTHRT 184

  Fly   161 -GSPLPDWLQCVDLQIVHNEECGWTYGS-VGDNVICTRTVDGKSICGGDSGGPL---VTHDGSKL 220
             |.     ||...||..::.:|....|. |..|.||...: |...|.|||||||   |.| ..|:
  Fly   185 RGV-----LQITQLQRYNSSQCMQALGRLVQQNQICAGRL-GSDTCNGDSGGPLFQTVRH-MDKM 242

  Fly   221 VGVSNFVSSNGCQSGAPAGFQRVTY-HLDWI 250
            ..|...|.|.|.:..:..|.....| :.|||
  Fly   243 RPVQFGVVSYGSRECSGIGVYTDVYSYADWI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 73/255 (29%)
Tryp_SPc 37..253 CDD:238113 75/256 (29%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 73/255 (29%)
Tryp_SPc 40..276 CDD:238113 75/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435801
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.