DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and CLIPB11

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_319991.3 Gene:CLIPB11 / 1280172 VectorBaseID:AGAP009214 Length:359 Species:Anopheles gambiae


Alignment Length:276 Identity:69/276 - (25%)
Similarity:103/276 - (37%) Gaps:86/276 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EGRITNGYAAPEGKAPYTVGL-GFSGGWWCGGSIIAHDWVLTAEHCIGDAASVIVYFGATWRTNA 97
            |.||..|..|...:.|:...| ..:|.:.|||::|...:||||.|||               .|.
Mosquito   111 EDRIAFGQDARLFQYPWMALLKQRAGNFVCGGTLINERYVLTAAHCI---------------KNN 160

  Fly    98 QFTHTVGNGNF----------------------------------IKHSNADIALIRIPHVDFWH 128
            ..| ||..|.|                                  .:....||.|:|:       
Mosquito   161 DIT-TVRLGEFDLSTPIDCDKRGEQCAPPPQDLFVEQTIVHEAYSARRKENDIGLVRL------- 217

  Fly   129 MVNKVELPSYNDR-----------YNNYNEWWAVACGWGGTYDGSPLPDWLQCVDLQIVHNEECG 182
                .:...|||.           .......:.|| |||.| :.:|..:.||...|.::.|::|.
Mosquito   218 ----AKEAEYNDNVLPICLPVTPAMRTTQTTYFVA-GWGAT-ESAPSSNRLQFTKLSLLSNDQCV 276

  Fly   183 W------TYGSVGDNVICTRTVDGKSICGGDSGGPLVTHD-GSKLV--GVSNF-VSSNGCQSGAP 237
            .      ::..|.::.:|....:....|.|||||||.|.. .::.|  ||.:: :.:.|.|| ||
Mosquito   277 QKLLRVDSFAKVNNDQMCAIGANLTDNCTGDSGGPLKTISINARYVQYGVVSYGLRTCGKQS-AP 340

  Fly   238 AGFQRVTYHLDWIRDH 253
            ..:.||..:.|||.:|
Mosquito   341 GVYTRVENYADWILEH 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 65/269 (24%)
Tryp_SPc 37..253 CDD:238113 66/271 (24%)
CLIPB11XP_319991.3 Tryp_SPc 113..353 CDD:214473 65/269 (24%)
Tryp_SPc 117..356 CDD:238113 65/268 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.