DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and LOC101731336

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_004916443.1 Gene:LOC101731336 / 101731336 -ID:- Length:300 Species:Xenopus tropicalis


Alignment Length:196 Identity:38/196 - (19%)
Similarity:57/196 - (29%) Gaps:60/196 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LAVASASAFDE---KVFVKDLPKATKIEGRITNGYAA-PEGKAPYTVGLGFSGGWWCGGSIIAHD 70
            :.|:.|:|.::   ||.:|....::     :..|.|| ..|:.|.|              .::|.
 Frog   148 IQVSIATAVEKESYKVMIKSCSNSS-----VCPGMAAFSNGQNPVT--------------YVSHH 193

  Fly    71 WVLTAEHCIGDAASVIVYFGATWRTNAQFTHTVGNGNFIK----HSNADIALIRIPHVDFWHMVN 131
            ...|..||                         .||:||.    ..|......:..|.....|..
 Frog   194 ECCTGTHC-------------------------NNGHFIDTEPGSENGLECYFQSSHQTVNKMAC 233

  Fly   132 KVELPSYNDRY-----NNYNEWWAVACGWGGTYDGSPLPDW--LQCVDLQIV-HNEECGWTYGSV 188
            :.|:....|..     |......|......|.|...|||.|  ..|....:. |:...|...|:.
 Frog   234 RGEMTQCADLIGASPDNILMSGCATQAFCQGLYPHFPLPGWKSTSCCSKSLCNHSNSTGPPTGAA 298

  Fly   189 G 189
            |
 Frog   299 G 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 32/167 (19%)
Tryp_SPc 37..253 CDD:238113 32/166 (19%)
LOC101731336XP_004916443.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.