DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sgs1 and FLO5

Sequence 1:NP_523475.3 Gene:Sgs1 FlyBaseID:FBgn0003372 Length:1286 Species:Drosophila melanogaster
Sequence 2:NP_012081.1 Gene:FLO5 SGDID:S000001254 Length:1075 Species:Saccharomyces cerevisiae

Alignment Length:1044 Identity:297/1045 (28%)
Similarity:432/1045 (41%) Gaps:176/1045 (17%)


  Fly   181 PCIDTSTVIPTSPCTQETTTPTPTCSTQGTQTTPCTCAQTT-----------TTPRSTTTTSTS- 233
            ||:.:|   .|.||.||.:.....|...|.    |:.:|..           |||.:.|...|. 
Yeast    86 PCVSSS---GTFPCPQEDSYGNWGCKGMGA----CSNSQGIAYWSTDLFGFYTTPTNVTLEMTGY 143

  Fly   234 -RPTTTTPRSTTTTTT--------------------SRPTTTT--------------PRSTTTTT 263
             .|..|...:.:..|.                    ..|.|:|              |.:.|.|.
Yeast   144 FLPPQTGSYTFSFATVDDSAILSVGGSIAFECCAQEQPPITSTNFTINGIKPWDGSLPDNITGTV 208

  Fly   264 TR-----RPTTTTPRCTTTTSTCAPTTTTPRSTTTTTT------------SRPTTTTPRCTTTTS 311
            ..     .|.........:..|...:...|..||.:..            |:...|.|..:..|:
Yeast   209 YMYAGYYYPLKVVYSNAVSWGTLPISVELPDGTTVSDNFEGYVYSFDDDLSQSNCTIPDPSIHTT 273

  Fly   312 TCSPTRTTPRSTTTTSTSRPTTTTPRCTTTPSTSRPTTTTPRSTTKTSTCAPTTTTPRPTTTPST 376
            :...|.|.|.:.|.||||      ...||...|:...|.......:|.|.|.|.||   ||.|.|
Yeast   274 STITTTTEPWTGTFTSTS------TEMTTITDTNGQLTDETVIVIRTPTTASTITT---TTEPWT 329

  Fly   377 SRPTTTTPRSTTTTSTS-RPTTTTPRSTTTTTTRRPTTTTPRSTTTTSTSRPTTTTPRSTTTTTT 440
            ...|:|:...||.|.|: :||..|.....|.|:....|||....|.|.||   |:|..:|.|.|.
Yeast   330 GTFTSTSTEMTTVTGTNGQPTDETVIVIRTPTSEGLITTTTEPWTGTFTS---TSTEMTTVTGTN 391

  Fly   441 SRPT--TTTPRSTTTTCTCSPTTTTPRSTTTTSTSRPTTTTPRSTTTTSTSG-PTTTTPRSTTTT 502
            .:||  |.....|.|:.....|||.|.:.|.||||...      ||.|.|:| ||..|.....|.
Yeast   392 GQPTDETVIVIRTPTSEGLITTTTEPWTGTFTSTSTEV------TTITGTNGQPTDETVIVIRTP 450

  Fly   503 TTSGPTTTTPRSTTTTCTCSPTTTTPRSTTTPSTSRPTTTTP---RSTTTTCTCSPTTTTPRSTT 564
            |:.|..|||....|.|.|   :|:|..:|.|.:..:||..|.   |:.|:....| |||.|.:.|
Yeast   451 TSEGLITTTTEPWTGTFT---STSTEMTTVTGTNGQPTDETVIVIRTPTSEGLIS-TTTEPWTGT 511

  Fly   565 TTSTSRPTTTTPRSTTTTTTSRPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTT 629
            .||||...|     |.|.|..:||..|.....|.::.|..|||....|.|.||    |:...||.
Yeast   512 FTSTSTEVT-----TITGTNGQPTDETVIVIRTPTSEGLITTTTEPWTGTFTS----TSTEMTTV 567

  Fly   630 TSTSG-PTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSG-PTTTTP---R 689
            |.|:| ||..|.....|.::.|..|.|....|.|.||    |:...||.|.|:| ||..|.   |
Yeast   568 TGTNGQPTDETVIVIRTPTSEGLITRTTEPWTGTFTS----TSTEVTTITGTNGQPTDETVIVIR 628

  Fly   690 STTTTSTSGPTTTTPRSTTTTSTSGPTTTT--PRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTP 752
            :.||..:|..::::.:.|::.::|.|..|.  |.:.|:..:|...:::..|:..||:|..:::..
Yeast   629 TPTTAISSSLSSSSGQITSSITSSRPIITPFYPSNGTSVISSSVISSSVTSSLVTSSSFISSSVI 693

  Fly   753 RSTTTTSTS--GPTTTTPRSTTTTSTSGPT-TTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTT 814
            .|:||||||  ..::|:....|::||||.: :.|..:::::|:|..::.:|:|.|.:|:|.|..|
Yeast   694 SSSTTTSTSIFSESSTSSVIPTSSSTSGSSESKTSSASSSSSSSSISSESPKSPTNSSSSLPPVT 758

  Fly   815 TPRSTT---TTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPT 876
            :  :||   |.|:..|.|||..|..||..:  .|:......|.|.|....:|...|.:..|:..|
Yeast   759 S--ATTGQETASSLPPATTTKTSEQTTLVT--VTSCESHVCTESISSAIVSTATVTVSGVTTEYT 819

  Fly   877 TTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSCPTTTTPRSTTTTCTSGPTT 941
            |..|.|||.|:.....||.....||..|   |.||.::|..|.:||.:....::.:....|..|.
Yeast   820 TWCPISTTETTKQTKGTTEQTKGTTEQT---TETTKQTTVVTISSCESDICSKTASPAIVSTSTA 881

  Fly   942 TTPRSTTTTCTSCPTTTTPRSTTTTCTSCPTTTTPRSTTTTCTSGPTTTTPRSTTKTSTCAPTTT 1006
            |....||...|.||.:||.....||..          |.|:|.||             .|:.||:
Yeast   882 TINGVTTEYTTWCPISTTESKQQTTLV----------TVTSCESG-------------VCSETTS 923

  Fly  1007 TPRSTTTTSTSRPTTTTPRSTTTTTTSRPTTTTPRSTTTPSTSRPTTTTPRSTTTTSTSRPTTTT 1071
            ....:|.|:|....      .|...|.||.||..:|.    :|:..:.|..:||.|..:...|..
Yeast   924 PAIVSTATATVNDV------VTVYPTWRPQTTNEQSV----SSKMNSATSETTTNTGAAETKTAV 978

  Fly  1072 PRSTTK-----TSTCAPTTTTPRSTTTTTTSRPTTTTPRSTTTTTTSRPTTTTPRSTTTPCTSRP 1131
            ..|.::     |.|.:.|.....|::..:.|.     ..:|.:.|:|..:|.:.:..:||.:|..
Yeast   979 TSSLSRFNHAETQTASATDVIGHSSSVVSVSE-----TGNTMSLTSSGLSTMSQQPRSTPASSMV 1038

  Fly  1132 TTTT 1135
            .::|
Yeast  1039 GSST 1042

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sgs1NP_523475.3 None
FLO5NP_012081.1 PA14 100..249 CDD:284994 23/153 (15%)
Flocculin 503..540 CDD:279018 17/42 (40%)
Flocculin_t3 784..825 CDD:290639 10/43 (23%)
Flocculin_t3 859..897 CDD:290639 10/38 (26%)
Flocculin_t3 905..948 CDD:290639 17/72 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126579
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.