DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sgs1 and FLO11

Sequence 1:NP_523475.3 Gene:Sgs1 FlyBaseID:FBgn0003372 Length:1286 Species:Drosophila melanogaster
Sequence 2:NP_012284.3 Gene:FLO11 SGDID:S000001458 Length:1367 Species:Saccharomyces cerevisiae

Alignment Length:1259 Identity:483/1260 (38%)
Similarity:644/1260 (51%) Gaps:274/1260 (22%)


  Fly    23 NYDWDSMQDGPSEEIIPGCGGDTIYYPDPVQPCDTDSNPTTTKPRQKTKRPKSTRRTTKRTKRPR 87
            |||    ..|.|:...||     .|:     ..|.|:|...||        .||           
Yeast   181 NYD----NQGHSQTDFPG-----FYW-----NIDCDNNCGGTK--------SST----------- 212

  Fly    88 RKTTKWTTKRATKRTTKRTTRRRPTTPKTPDTTDSPITTTGAECTCSDRTTASSTDSTTDRTTVT 152
              ||..|::.:|  ||..|:....||..|.:               |..||:|:::|:|..:|..
Yeast   213 --TTSSTSESST--TTSSTSESSTTTSSTSE---------------SSTTTSSTSESSTSSSTTA 258

  Fly   153 NTDWTTPLCT---DTPPCT--CSEESSTAIPSSPCIDTSTVIPTSPCTQETTTPTPTCSTQGTQT 212
            ....||..||   .|||.|  |::|.    |:.|..|      |:|||::.||.:.||:.:.|..
Yeast   259 PATPTTTSCTKEKPTPPTTTSCTKEK----PTPPHHD------TTPCTKKKTTTSKTCTKKTTTP 313

  Fly   213 TPCTCAQTTTTPRSTTTTSTSRPTTTTPRSTTTTTTSRPTTTTPRSTTTTTTRRPTTTTPRCTTT 277
            .|        ||.|:||.|:|.| ..||.|:||.::|.|.|    |:||.::..| ..||..:||
Yeast   314 VP--------TPSSSTTESSSAP-VPTPSSSTTESSSAPVT----SSTTESSSAP-VPTPSSSTT 364

  Fly   278 TSTCAPTTTTPRSTTTTTTSRPTTTTPRCTTTTSTCSPTRTTPRSTTTTSTSRPTTTTPRCTTTP 342
            .|:.||.|    |:||.::|.|.|:    :||.|:.:|. .||.|:||.|:|.|.|:    :||.
Yeast   365 ESSSAPVT----SSTTESSSAPVTS----STTESSSAPV-PTPSSSTTESSSAPVTS----STTE 416

  Fly   343 STSRPTTTTPRSTTKTSTCAPTTTTPRPTTTPSTSRPTTTTPRSTTTTSTSRPTTTTPRSTTTTT 407
            |:|.|.|:   |||::|: ||.|:    :||.|:|.|.|    |:||.|:|.| ..||.|:||.:
Yeast   417 SSSAPVTS---STTESSS-APVTS----STTESSSAPVT----SSTTESSSAP-VPTPSSSTTES 468

  Fly   408 TRRPTTTTPRSTTTTSTSRPTTTTPRSTTTTTTSRPTTTTPRSTTTTCTCSPTTTTPRSTTTTST 472
            :..|.|    |:||.|:|.| ..||.|:||.::|.|.|    |:||..:.:| ..||.|:||.|:
Yeast   469 SSAPVT----SSTTESSSAP-VPTPSSSTTESSSAPVT----SSTTESSSAP-VPTPSSSTTESS 523

  Fly   473 SRPTTTTPRSTTTTSTSGPTTTTPRSTTTTTTSGPTTTTPRSTTTTCTCSPTTTTPRSTTTPSTS 537
            |.| ..||.|:||.|:|.|.|    |:||.::|.| ..||.|:||..:.:|.|    |:||.|:|
Yeast   524 SAP-APTPSSSTTESSSAPVT----SSTTESSSAP-VPTPSSSTTESSSTPVT----SSTTESSS 578

  Fly   538 RPTTTTPRSTTTTCTCSPTTTTPRSTTTTSTSRPTTTTPRSTTTTTTSRPTTTTPRSTTTTSTSG 602
            .| ..||.|:||..:.:| ..||.|:||.|:|.| ..||.|:||.::|.|.|    |:||.|:|.
Yeast   579 AP-VPTPSSSTTESSSAP-VPTPSSSTTESSSAP-APTPSSSTTESSSAPVT----SSTTESSSA 636

  Fly   603 PTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGP 667
            | ..||.|:||.|:|.| ..||.|:||.|:|.| ..||.|:||.|:|.|.|    |:||.|:|.|
Yeast   637 P-VPTPSSSTTESSSAP-VPTPSSSTTESSSAP-VPTPSSSTTESSSAPVT----SSTTESSSAP 694

  Fly   668 TTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPT 732
            .|    |:||.|:|.| ..||.|:||.|:|.| ..||.|:||.|:|.| ..||.|:||.|:|.|.
Yeast   695 VT----SSTTESSSAP-VPTPSSSTTESSSAP-VPTPSSSTTESSSAP-VPTPSSSTTESSSAPV 752

  Fly   733 TTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTT 797
            |    |:||.|:|.| ..||.|:||.|:|.| ..||.|:||.|:|.| ..||.|:||.|:..| .
Yeast   753 T----SSTTESSSAP-VPTPSSSTTESSSAP-VPTPSSSTTESSSAP-VPTPSSSTTESSVAP-V 809

  Fly   798 TTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTT 862
            .||.|::..::|.| ::||.|::|.|:|.| ..||.|:||.|:|.|.     |::||.:|.....
Yeast   810 PTPSSSSNITSSAP-SSTPFSSSTESSSVP-VPTPSSSTTESSSAPV-----SSSTTESSVAPVP 867

  Fly   863 TPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRST------TTTSTSGPTTTTPRST-TTTST 920
            ||.|::..::|.| ::.|.|:||.|.|..||.||.|:      |.||.|..|.||...| ||||.
Yeast   868 TPSSSSNITSSAP-SSIPFSSTTESFSTGTTVTPSSSKYPGSQTETSVSSTTETTIVPTKTTTSV 931

  Fly   921 SCPTTTTPRSTTTTCTSGPTTTTPRSTTTTCT-SCPTTTTPRSTTTTCTSCPTTTTPRSTTTTCT 984
            :.|:|||  .|||.|::|  |.:...||:.|: ...|||.|.:|||:.|:..|||.   |||.|:
Yeast   932 TTPSTTT--ITTTVCSTG--TNSAGETTSGCSPKTVTTTVPTTTTTSVTTSSTTTI---TTTVCS 989

  Fly   985 SGPTTTTPRSTTKTSTCAP---TTTTPRSTTTTST-SRPTTTTPRSTTTTTTSRPTTTTPRSTTT 1045
            :|    |..:...||.|:|   |||.|.||:.:.| |..|||:|.:..||..|....||..||:|
Yeast   990 TG----TNSAGETTSGCSPKTITTTVPCSTSPSETASESTTTSPTTPVTTVVSTTVVTTEYSTST 1050

  Fly  1046 PSTSRPTTT----------------TPRSTTTTSTSRPTTTTPRSTT-------KTSTCAP---T 1084
            ......|||                ||..||.|:.:..|.||...:|       .||.|:|   |
Yeast  1051 KPGGEITTTFVTKNIPTTYLTTIAPTPSVTTVTNFTPTTITTTVCSTGTNSAGETTSGCSPKTVT 1115

  Fly  1085 TTTPRST---------TTTTTSRPTT---TTPRSTTT----------TTTSRPTT--TT--PRST 1123
            ||.|.||         ||..|:..||   ||..||.|          ||.|.|||  ||  |.:.
Yeast  1116 TTVPCSTGTGEYTTEATTLVTTAVTTTVVTTESSTGTNSAGKTTTGYTTKSVPTTYVTTLAPSAP 1180

  Fly  1124 TTPCTSR-PT--TTTPRSTTTT----TTS-----------------RPTTTTPRSTTTPCPTT-- 1162
            .||.|:. ||  |||..|..|.    |||                 .|:.|||  .||..|||  
Yeast  1181 VTPATNAVPTTITTTECSAATNAAGETTSVCSAKTIVSSASAGENTAPSATTP--VTTAIPTTVI 1243

  Fly  1163 -------TPSASPTRTTTTRRPCP 1179
                   |.||..|.|..|.:..|
Yeast  1244 TTESSVGTNSAGETTTGYTTKSIP 1267

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sgs1NP_523475.3 None
FLO11NP_012284.3 Flo11 43..193 CDD:287191 5/16 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126579
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.