DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sgs1 and HPF1

Sequence 1:NP_523475.3 Gene:Sgs1 FlyBaseID:FBgn0003372 Length:1286 Species:Drosophila melanogaster
Sequence 2:NP_014487.1 Gene:HPF1 SGDID:S000005515 Length:967 Species:Saccharomyces cerevisiae

Alignment Length:966 Identity:236/967 (24%)
Similarity:384/967 (40%) Gaps:219/967 (23%)


  Fly   371 TTTPSTSRPTTTTPRSTTTTSTSRPTTTTPRSTTTTTTRRPTTTTPRSTTTTSTSRPTTTTPRST 435
            |.:.|.:..::|...||::.|.|..::....|:|:..:...|..|..||..:|:..|:|::...:
Yeast    27 TNSSSIASNSSTAVSSTSSGSVSISSSIELTSSTSDVSSSLTELTSSSTEVSSSIAPSTSSSEVS 91

  Fly   436 TTTTTSRPTTTTPRSTTTTCTCSPTTTTPRSTTTTSTSRPTTTTPRSTTTTSTSGPTTTTPRSTT 500
            ::.|:|..:.    |.:::.|.|.::.:..|:.|.|.|..:.::..:.:.:|.||.:|:....::
Yeast    92 SSITSSGSSV----SGSSSITSSGSSVSSSSSATESGSSASGSSSATESGSSVSGSSTSITSGSS 152

  Fly   501 TTTTSGPTTTTPRSTT---TTCTCSPTTTTPRSTTTPSTSRPTTTTPRSTTTTCTCSPTTTTPRS 562
            :.|.||.:.:...|.|   ::.:.|.:.|...|:.:.|:|...:.:..|.:::.|.|.::.:..|
Yeast   153 SATESGSSVSGSTSATESGSSASGSSSATESGSSASGSSSATESGSSVSGSSSATESGSSVSGSS 217

  Fly   563 TTTTSTSRPTTTTPRSTTTTTTSRPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRST 627
            :.|.|.|  .::.|.|:.:.|.|..:::...|:.|.|      .|...::.:||||..|.:..|.
Yeast   218 SATESGS--ASSVPSSSGSVTESGSSSSASESSITQS------GTASGSSASSTSGSVTQSGSSV 274

  Fly   628 TTTSTS---GPTTTTPRSTTTTST-SGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSG----PT 684
            :.:|.|   |.:::.|:||::.|| ||..|:...|:.|:|.|..|.|.  |.:.:|:.|    |:
Yeast   275 SGSSASSAPGISSSIPQSTSSASTASGSITSGTLSSITSSASSATATA--SNSLSSSDGTIYLPS 337

  Fly   685 TTTPRSTTTTST---------------------------------------SGPT---------- 700
            ||.....|.|.:                                       |.||          
Yeast   338 TTISGDITLTGSVIATEAVEVAAGGKLTLLDGDKYVFSADFIIHGGVFVEKSKPTYPGTEFDISG 402

  Fly   701 ------TTTPRSTTTTSTSGPTTTTPRS---------TTTTSTSGPTTTTPRSTT---------- 740
                  .|........|::...:.||.|         :.:.||.|..|.:|.|.:          
Yeast   403 ENFDVSGTFNAEEPAASSASAYSFTPGSFDNSGDISLSLSESTKGEVTFSPYSNSGAFSFSNAIL 467

  Fly   741 ---------TTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSG------PTTTTPRSTTTT 790
                     ..:.||.......:....||.........|.|....||      |.|.|.: |...
Yeast   468 NGGSVSGLQRRAESGSVNNGEINLENGSTYVVVEPVSGSGTINIISGNLYLHYPDTFTGQ-TVVF 531

  Fly   791 STSGPTTTTPRSTTTTS--------------TSGPTTTTPRSTT--TTSTSGPTTTTPRSTTTTS 839
            ...|.....|..|.||.              |:..|..:..|.|  .|:|.|.:..:....|..|
Yeast   532 KGEGVLAVDPTETNTTPIPVVGYTGENQIAITADVTALSYDSATGVLTATQGNSQFSFSIGTGFS 596

  Fly   840 TSG----------------------PTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTT---TT 879
            :||                      .::.||.||:|||.:           |.||||.|:   :.
Yeast   597 SSGFNVSEGTFAGAYAYYLNYGGVVASSATPSSTSTTSGA-----------TNSTSGSTSFGASV 650

  Fly   880 PRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTST---SCPTTTTPRSTTTTCTSGPTT 941
            ..||.:||.....|.:..||..:.:....|||....|||||   ||..||.......|.    ||
Yeast   651 TGSTASTSFGASVTGSTASTLISGSPSVYTTTLTYATTTSTVVVSCSETTDSNGNVYTI----TT 711

  Fly   942 TTP-RSTTTTCTSCPTTTTPRSTTTTCTSCPTTTTPRSTTTTCT----SGPTTTTPRSTTKTSTC 1001
            |.| .|||.|.|||..|....:|:|...:..|.::...||.|.|    :|..|.|..|.....|.
Yeast   712 TVPCSSTTATITSCDETGCHVTTSTGTVATETVSSKSYTTVTVTHCDNNGCNTKTVTSECPEETS 776

  Fly  1002 APTTTTPRSTTTTSTSRPTTTTPRSTTTTTTSRPTTTTPRSTTTPSTSRPTTTTPRSTTTTSTSR 1066
            | |||:|:|.||.:.:. ......:|.|.|:..|..||  :|.:|.|....|.|.......||..
Yeast   777 A-TTTSPKSYTTVTVTH-CDDNGCNTKTVTSEAPEATT--TTVSPKTYTTATVTQCDDNGCSTKT 837

  Fly  1067 PTTTTPRSTTKTSTCAPTTTTPRSTTTTTTSR----------PTTTTPRSTTTTTTSRPTTTTPR 1121
            .|:..|:.|::||   .|:..|::.||.|.::          .|:..|.:|:|.|.         
Yeast   838 VTSEAPKETSETS---ETSAAPKTYTTATVTQCDDNGCNVKIITSQIPEATSTVTA--------- 890

  Fly  1122 STTTPCTSRPTTTTPRSTTTTTT--SRPT--TTTPRSTTTPCPTTTPSASPTRTTT 1173
                      |:.:|:|.||.|:  |:.|  ||.....::...|.:.||:|.:|:|
Yeast   891 ----------TSASPKSYTTVTSEGSKATSLTTAISKASSAISTYSKSAAPIKTST 936

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sgs1NP_523475.3 None
HPF1NP_014487.1 Hyphal_reg_CWP 337..616 CDD:288598 46/280 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126579
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.