DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sgs1 and HKR1

Sequence 1:NP_523475.3 Gene:Sgs1 FlyBaseID:FBgn0003372 Length:1286 Species:Drosophila melanogaster
Sequence 2:NP_010708.1 Gene:HKR1 SGDID:S000002828 Length:1802 Species:Saccharomyces cerevisiae

Alignment Length:1314 Identity:327/1315 (25%)
Similarity:548/1315 (42%) Gaps:320/1315 (24%)


  Fly   118 DTTDSPITTTGAECTCSDRTTA-SSTDSTTDRTTVTNTDWTTPLCTDTPPCTCSEESSTAIPSSP 181
            ||..|.....|.|.|.|..|:| |||.|:.....:|::..||.:...     ..|..||.|... 
Yeast    25 DTIYSTSYNNGIESTPSYSTSAISSTGSSNKENAITSSSETTTMAGQ-----YGESGSTTIMDE- 83

  Fly   182 CIDTSTVIPTSPCTQETTTPTPTCSTQGTQTTPCTCAQTTTTPRSTTTTSTSRPT-TTTPRSTTT 245
                          |||.|.:...|.            ||||..|.|.:|..:.| ..||.|:..
Yeast    84 --------------QETGTSSQYISV------------TTTTQTSDTMSSVKKSTEIATPSSSIV 122

  Fly   246 TT----------TSRPTTTTPRS---TTTTTTRRPTTTTPRCTTTTSTCAPTTTTPRSTTTTTTS 297
            .|          .|:..:..|:|   :.:.||...::::...:|:.|:..|...:|..||.:..|
Yeast   123 PTPLQSYSDESQISQTLSHNPKSVAESDSDTTSSESSSSVIISTSDSSAVPREISPIITTDSQIS 187

  Fly   298 RPTTTTPRCTTTTSTCSPTRTTPR-----STTTTST----SRPTTTTPRCTTTP----------- 342
            :...|..:.::.:.|....:...|     |.|..||    |..:|.|....|..           
Yeast   188 KEEGTLAQTSSISETTRIAQMVTRVSQISSITAASTIDGFSSESTQTDFSNTVSFENSVEEEYAM 252

  Fly   343 STSRPTTTTPRSTTKTSTCAPTT--TTPRPTTTPSTSRPTTTTPRSTTTTSTSRPT--TTTPRST 403
            |.|:.:.:...|:|..|....|.  |:..|.|:.|:|...||   ||.|:.:||..  .:.|.|.
Yeast   253 SKSQLSESYSSSSTVYSGGESTADKTSSSPITSFSSSYSQTT---STETSESSRVAVGVSRPSSI 314

  Fly   404 TTTTTRRPTTTTPRSTTTTST----------------SRPTTTTPRSTTTTTTSRPTTTTPRSTT 452
            |.||:   ..:...|....||                .||.|    |:|..|:|..:....|.:.
Yeast   315 TQTTS---IDSFSMSEVELSTYYDLSAGNYPDQELIVDRPAT----SSTAETSSEASQGVSRESN 372

  Fly   453 TTCTCSPTTT----TPRSTTTTSTSRPTTTTPRST--------TTTST-------SGPTTTTPRS 498
            |....|.:||    :..|.|..||| .|.|.|.|:        |::||       |.|:.:...|
Yeast   373 TFAVSSISTTNFIVSSASDTVVSTS-STNTVPYSSVHSTFVHATSSSTYISSSLYSSPSLSASVS 436

  Fly   499 TTTTTTSGPT-----TTTPRSTTTTCTCSPTTTTPRSTTTPSTSRPTTTTPRSTTTTCTCSPTTT 558
            :.......|:     ::.|.:.::|.|.||:.    |...||....:.:.|.:.::|.|.||  :
Yeast   437 SHFGVAPFPSAYISFSSVPVAVSSTYTSSPSA----SVVVPSAYASSPSVPVAVSSTYTSSP--S 495

  Fly   559 TPRSTTTTSTSRPTTTTPRSTTTTTTSRPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTT 623
            .|.:.::|.||.|  :.|.:.::|.||.|  :.|.:.::|.||.|  :.|.:.::|.||.|  :.
Yeast   496 APAAISSTYTSSP--SAPVAVSSTYTSSP--SAPAAISSTYTSSP--SAPVAVSSTYTSSP--SA 552

  Fly   624 PRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTP 688
            |.:.::|.||.|  :.|.:.::|.||.|  :.|.:.::|.||.|  :.|.:.::|.||.|  :.|
Yeast   553 PAAISSTYTSSP--SAPVAVSSTYTSSP--SAPVAISSTYTSSP--SVPVAVSSTYTSSP--SAP 609

  Fly   689 RSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPR 753
            .:.::|.||.|  :.|.:.::|.||.|  :.|.:.::|.||.|  :.|.:.::|.||.|  :.|.
Yeast   610 AAISSTYTSSP--SAPVAVSSTYTSSP--SAPAAISSTYTSSP--SVPVAVSSTYTSSP--SAPA 666

  Fly   754 STTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRS 818
            :.::|.||.|  :.|.:.::|.||.|  :.|.:.::|.||.|  :.|.:.::|.||.|  :.|.:
Yeast   667 AISSTYTSSP--SVPVAVSSTYTSSP--SAPAAISSTYTSSP--SAPVAVSSTYTSSP--SAPAA 723

  Fly   819 TTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRST 883
            .::|.||.|  :.|.:.::|.||.|  :.|.:.::|.||.|  :.|.:.::|.||.|:.....|:
Yeast   724 ISSTYTSSP--SAPVAVSSTYTSSP--SAPAAISSTYTSSP--SAPVAVSSTYTSSPSALVVLSS 782

  Fly   884 TTTSTSGPTTTTPRSTTTTSTSG--PTTTTPRSTTTTSTSCP-------TTTTPRSTTTT--CTS 937
            |:||:......:| ||....:||  |:.:...:.::||:|.|       :::..||:..|  .:.
Yeast   783 TSTSSPYDIVYSP-STFAAISSGYTPSPSASVAMSSTSSSSPYDIVYSLSSSASRSSIATYEFSP 846

  Fly   938 GPTTTTPRSTT------------------TTCTSCPT---TTTPR-------------------- 961
            .|:|:.|.|:|                  ||.|..||   :|..|                    
Yeast   847 SPSTSLPTSSTYTYFSSAYAFEFSSERYSTTSTIAPTQIHSTLSRITDFLLQTSMAIQSIVSQQI 911

  Fly   962 STTTTC-----TSCPTTTTPRSTTTTCTS------GPTTTTPRSTTKTSTCAPTTTTPRSTTTTS 1015
            ||::|.     :|..:...|.::....||      ..:.|:|:::.|.|:.       :|..::|
Yeast   912 STSSTLNDEIHSSALSVFNPSASNLVETSLIISSTQASITSPKNSAKISSL-------QSQLSSS 969

  Fly  1016 TSRP-------TTTTPRSTT------TTTTSRPT----TTTPRSTTTPSTSR-------PT---T 1053
            |..|       |.|:.|||.      |::.::|.    :.||...||.|:|.       |:   :
Yeast   970 TKNPYDTANKNTETSGRSTVVSNFLYTSSAAKPDNEKFSATPTEITTISSSSHAYSLSIPSSHNS 1034

  Fly  1054 TTPRSTTTTSTSRPTTTTPRSTTKTSTC-----------APTTTTPRSTTTTTTSRPTTTTPRS- 1106
            .|..|.....:|:..|:...|::..|:.           :.:.|..|.|:.|:|.|..:.:.:| 
Yeast  1035 VTGLSHNFVDSSKSATSFGYSSSSISSIKLSKETIPASKSVSNTQERITSFTSTLRANSQSEKSE 1099

  Fly  1107 --------TTTTTTSRPTTTTPRSTTTPCTSRPTTTTPRS-------TTTTTTSRPTTTT----P 1152
                    .::..:|.|:.:|.....:...||..:.|...       |||.|..:.::.|    .
Yeast  1100 GRNSVGSLQSSHISSNPSLSTNTKVDSKSLSRKVSKTMGENGEETGLTTTKTQYKSSSETSGSYS 1164

  Fly  1153 RSTTT----PCPTTTPSASPTRTTTTRRPCPCHPQPPYQIPPWSWWYP----------------- 1196
            ||.|.    |..|...:.:.|.:..|......:|..||..|....|.|                 
Yeast  1165 RSFTKISIGPATTAVQTQASTNSVFTAPALSTYPTTPYPSPNSYAWLPTAIIVESSETGPTTASF 1229

  Fly  1197 NP----TYPNPVWP 1206
            ||    :.||.:.|
Yeast  1230 NPSITGSLPNAIEP 1243

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sgs1NP_523475.3 None
HKR1NP_010708.1 PLN02217 <397..506 CDD:215130 28/116 (24%)
PHA03307 452..>776 CDD:223039 113/368 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126579
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.