DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sgs1 and FLO1

Sequence 1:NP_523475.3 Gene:Sgs1 FlyBaseID:FBgn0003372 Length:1286 Species:Drosophila melanogaster
Sequence 2:NP_009424.1 Gene:FLO1 SGDID:S000000084 Length:1537 Species:Saccharomyces cerevisiae

Alignment Length:1233 Identity:392/1234 (32%)
Similarity:537/1234 (44%) Gaps:232/1234 (19%)


  Fly   117 PDTTDSPITTTGAECTCSDRTTASSTDSTTDRTTVTNTDWT----TPLCTDTPPCTCSEESSTAI 177
            ||.::..::||   .|.::..|.:.|.::|:.||||.|:..    |.:...||        :|| 
Yeast   266 PDPSNYAVSTT---TTTTEPWTGTFTSTSTEMTTVTGTNGVPTDETVIVIRTP--------TTA- 318

  Fly   178 PSSPCIDTSTVIPTSPCTQETTTPTPTCSTQGTQTTPCTCAQTTTTPRSTTTTSTSRPTTTTPRS 242
                    ||:|.|:.....|.|.|.|..|..|.|......:|....| |.||:|:..|||.|.:
Yeast   319 --------STIITTTEPWNSTFTSTSTELTTVTGTNGVRTDETIIVIR-TPTTATTAITTTEPWN 374

  Fly   243 TTTTTTSRPTTTT------PRSTTTTTTRRPTTTTPRCTTT-----TSTCAPTTTTPRSTTTTTT 296
            :|.|:||...||.      |...|....|.|||.|...|||     |.|   :|:|..:|.|.|.
Yeast   375 STFTSTSTELTTVTGTNGLPTDETIIVIRTPTTATTAMTTTQPWNDTFT---STSTELTTVTGTN 436

  Fly   297 SRPTTTTPRC--TTTTSTCSPTRTTPRSTTTTSTSRPTTTTPRC-------------TTTPSTSR 346
            ..||..|...  |.||:|.:.|.|.|.:.|.||||...||....             |.|.:|:.
Yeast   437 GLPTDETIIVIRTPTTATTAMTTTQPWNDTFTSTSTELTTVTGTNGLPTDETIIVIRTPTTATTA 501

  Fly   347 PTTTTPRSTTKTSTCAPTTTT------PRPTT-----TPSTSRPTTTTPRSTTTTSTSRPTTTTP 400
            .|||.|.:.|.|||....||.      |...|     ||:|:....|||:....|.||   |:|.
Yeast   502 MTTTQPWNDTFTSTSTEITTVTGTNGLPTDETIIVIRTPTTATTAMTTPQPWNDTFTS---TSTE 563

  Fly   401 RSTTTTTTRRPT--TTTPRSTTTTSTSRPTTTTPRSTTTTTTSRPTTTTPRS------------- 450
            .:|.|.|...||  |.....|.||:|:..|||.|.::|.|:||...||...:             
Yeast   564 MTTVTGTNGLPTDETIIVIRTPTTATTAITTTEPWNSTFTSTSTEMTTVTGTNGLPTDETIIVIR 628

  Fly   451 TTTTCTCSPTTTTPRSTTTTSTSRPTTTTPRSTTTTSTSG-PT--TTTPRSTTTTTTSGPTTTTP 512
            |.||.|.:.|||.|.:.|.||||      ...||.|.|:| ||  |.....|.||.|:..|||.|
Yeast   629 TPTTATTAITTTQPWNDTFTSTS------TEMTTVTGTNGLPTDETIIVIRTPTTATTAMTTTQP 687

  Fly   513 RSTTTTCTCSPTTTTPRSTTTPSTSRPT--TTTPRSTTTTCTCSPTTTTPRSTTTTSTSRPTTT- 574
            .:.|.|     :|:|..:|.|.:|..||  |.....|.||.|.:.|||.|.:.|.||||...|| 
Yeast   688 WNDTFT-----STSTEITTVTGTTGLPTDETIIVIRTPTTATTAMTTTQPWNDTFTSTSTEMTTV 747

  Fly   575 -----TPRSTTTTTTSRPTTTTPRSTTTTSTSGP-TTTTPRSTTTTSTSG-PTTTTPRSTTTTST 632
                 .|...|......||:....||||...:|. |:|:...||.|.|:| ||..|.....|.::
Yeast   748 TGTNGVPTDETVIVIRTPTSEGLISTTTEPWTGTFTSTSTEMTTVTGTNGQPTDETVIVIRTPTS 812

  Fly   633 SGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSG------------PTTTTPRSTTTTSTSGP-T 684
            .|..|||....|.|.||    |:...||.|.|:|            ||:....||||...:|. |
Yeast   813 EGLVTTTTEPWTGTFTS----TSTEMTTITGTNGVPTDETVIVIRTPTSEGLISTTTEPWTGTFT 873

  Fly   685 TTTPRSTTTTSTSG------------PTTTTPRSTTTTSTSGP-TTTTPRSTTTTSTSG------ 730
            :|:...||.|.|:|            ||:....||||...:|. |:|:...|..|.|:|      
Yeast   874 STSTEMTTITGTNGQPTDETVIVIRTPTSEGLISTTTEPWTGTFTSTSTEMTHVTGTNGVPTDET 938

  Fly   731 ------PTTTTPRSTTTTSTSGP-TTTTPRSTTTTSTSG------------PTTTTPRSTTTTST 776
                  ||:....||||...:|. |:|:...||.|.|:|            ||:....||||...
Yeast   939 VIVIRTPTSEGLISTTTEPWTGTFTSTSTEVTTITGTNGQPTDETVIVIRTPTSEGLISTTTEPW 1003

  Fly   777 SGP-TTTTPRSTTTTSTSG-PTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTS 839
            :|. |:|:...||.|.|:| ||..|.....|.::.|..|||....|.|.||   |:|..||.|.:
Yeast  1004 TGTFTSTSTEMTTVTGTNGQPTDETVIVIRTPTSEGLVTTTTEPWTGTFTS---TSTEMSTVTGT 1065

  Fly   840 TSGPT----------TTTPRSTTTTSTSGPTTT---------TP---------------RSTTTT 870
            ...||          ||...|:.::|:||..|:         ||               .|:.|:
Yeast  1066 NGLPTDETVIVVKTPTTAISSSLSSSSSGQITSSITSSRPIITPFYPSNGTSVISSSVISSSVTS 1130

  Fly   871 S--TSGP--TTTTPRSTTTTSTSGPTTTTPRST--TTTSTSGPT-TTTPRSTTTTSTSCPTTTTP 928
            |  ||.|  :::...|:||||||..:.::..|.  |::||||.: :.|..:.:.:|:|..::.:.
Yeast  1131 SLFTSSPVISSSVISSSTTTSTSIFSESSKSSVIPTSSSTSGSSESETSSAGSVSSSSFISSESS 1195

  Fly   929 RSTTTTCTSGPTTTTPRSTTTTCTSCP----TTTTPRSTTTTCTSCPTTTTPRSTTTTCTSGPTT 989
            :|.|.:.:|.|..|:..::..|.:|.|    |.|:.::|..|.|||.:.....|.:....|..|.
Yeast  1196 KSPTYSSSSLPLVTSATTSQETASSLPPATTTKTSEQTTLVTVTSCESHVCTESISPAIVSTATV 1260

  Fly   990 TTPRSTTKTSTCAPTTTTPRSTTTTSTSRPTTTTPRSTTTTTTSRPTTTTPRSTTTPSTSRPTTT 1054
            |....||:.:|..|.:||..:..|..|:..||.|.:.||..|.|...:.....|.:|:....:|.
Yeast  1261 TVSGVTTEYTTWCPISTTETTKQTKGTTEQTTETTKQTTVVTISSCESDVCSKTASPAIVSTSTA 1325

  Fly  1055 TPRSTTTTSTSRPTTTTPRSTTKT--STCAPTTTTPRSTTTTTTSRP------TTTTPRSTTTTT 1111
            |....||    ..||..|.|||::  .|...|.|:..|...:.|:.|      |.|.....|...
Yeast  1326 TINGVTT----EYTTWCPISTTESRQQTTLVTVTSCESGVCSETASPAIVSTATATVNDVVTVYP 1386

  Fly  1112 TSRPTTTTPRSTTTPCTSRPTTTTPRSTTTTTTSRPTTTTPRSTTTPCPTTTPSASPTRTTTT 1174
            |.||.|....|.    :|:..:.|..:||.|..:..||.|..:.|    .|...|:.|:|..|
Yeast  1387 TWRPQTANEESV----SSKMNSATGETTTNTLAAETTTNTVAAET----ITNTGAAETKTVVT 1441

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sgs1NP_523475.3 None
FLO1NP_009424.1 PA14 100..249 CDD:284994
Flocculin_t3 1235..1276 CDD:290639 12/41 (29%)
Flocculin_t3 1303..1341 CDD:290639 10/42 (24%)
Flocculin_t3 1349..1392 CDD:290639 12/43 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126579
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.