DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sgs1 and FIG2

Sequence 1:NP_523475.3 Gene:Sgs1 FlyBaseID:FBgn0003372 Length:1286 Species:Drosophila melanogaster
Sequence 2:NP_010013.2 Gene:FIG2 SGDID:S000000685 Length:1609 Species:Saccharomyces cerevisiae

Alignment Length:1355 Identity:357/1356 (26%)
Similarity:565/1356 (42%) Gaps:316/1356 (23%)


  Fly    34 SEEIIPGCGGDTIYYPDPVQPCDTDSNPTTTKPRQKTKRPKSTRRTTKRTKRPRRKTTKWTTKRA 98
            |..:.|..|.|:|.:       :..|.|:.|..........|...:...|......|...:..||
Yeast   283 SSSMAPTSGSDSISH-------NFTSPPSKTSGNYDVLTSNSIDPSLFTTTSEYSSTQLSSLNRA 340

  Fly    99 TKRTTKRTTRRRPTTPKTPDTTDS---PITTTGAECTCSDRTTASS--TDSTTDRTTVTNTDWTT 158
            :|..|...|....:||...|:..|   ||::.|        :||||  ..||.:.:|..|::: .
Yeast   341 SKSETVNFTASIASTPFGTDSATSLIDPISSVG--------STASSFVGISTANFSTQGNSNY-V 396

  Fly   159 PLCTDTPPCTCSEESSTAIPSSPCIDTSTVIPTSPCTQ----ETTTP----TPTCSTQGTQT--- 212
            |..|.:......:.||:::|.|   .|:.|:..:..||    .||:|    |.|.:..|..|   
Yeast   397 PESTASGSSQYQDWSSSSLPLS---QTTWVVINTTNTQGSVTSTTSPAYVSTATKTVDGVITEYV 458

  Fly   213 TPCTCAQT-----------TTTPRS---------TTTTSTSRPTTTTPRSTTT--------TTTS 249
            |.|...||           ::.|::         ::.:||...:...|.||.:        :::|
Yeast   459 TWCPLTQTKSQAIGVSSSISSVPQASSFSGSSILSSNSSTLAASNNVPESTASGSSQYQDWSSSS 523

  Fly   250 RP----------TTTTPRSTTTTTT----RRPTTTTPRCTTTTSTCAPTTTTPR-----STTT-- 293
            .|          ||.|..|.|:||:    ...|.|.....|...|..|.|.|..     |::|  
Yeast   524 LPLSQTTWVVINTTNTQGSVTSTTSPAYVSTATKTVDGVITEYVTWCPLTQTKSQAIGISSSTIS 588

  Fly   294 -TTTSRPTT------TTPRCTTTTSTCSPTRTTPRSTTTTSTSRPTTTTPR------CTT----- 340
             |.||:|::      :|.:.:..|...:.|..|...|.:||.:.||..:..      ||:     
Yeast   589 ATQTSKPSSILTLGISTLQLSDATFKGTETINTHLMTESTSITEPTYFSGTSDSFYLCTSEVNLA 653

  Fly   341 TPSTSRPTTTTPRSTTKTSTCAPTT---TTPRPTTTPSTSRPTTTTPRSTTT-------TSTSRP 395
            :..:|.|..::...:|.|.|.:..|   |:..|:|  |.|.||..:...:::       ||.|..
Yeast   654 SSLSSYPNFSSSEGSTATITNSTVTFGSTSKYPST--SVSNPTEASQHVSSSVNSLTDFTSNSTE 716

  Fly   396 T---------TTTPRSTTTTTTRRPTT---TTPRSTTTT----STSRPTTTTPRSTTTTTTSRPT 444
            |         |::.:..:.|||:..|:   |...||.||    :.:..||..|.|:...|||...
Yeast   717 TIAVISNIHKTSSNKDYSLTTTQLKTSGMQTLVLSTVTTTVNGAATEYTTWCPASSIAYTTSISY 781

  Fly   445 TTTPRSTTTTCT---CSPTTTTPRSTTTTSTSRPTTTTPRSTTTTST----------SGPTTTTP 496
            .|.. .||..|:   |:||..|  |.|.||::.|..:|..||..:||          |..|..|.
Yeast   782 KTLV-LTTEVCSHSECTPTVIT--SVTATSSTIPLLSTSSSTVLSSTVSEGAKNPAASEVTINTQ 843

  Fly   497 RSTTTTTTSGPTTTTPRSTTTTCTCSPTTT-------------TPRSTTTPSTSRPTTTTPRSTT 548
            .|.|:..||..|..:..|.|.|.:.|.||:             |...|||.|...|..:|....|
Yeast   844 VSATSEATSTSTQVSATSATATASESSTTSQVSTASETISTLGTQNFTTTGSLLFPALSTEMINT 908

  Fly   549 T----------TCTCSPTTTTPRSTTTTSTSRPTTTTPRSTTT--------TTTSRPTTTTPRST 595
            |          |..||.:...|...|...||:.|.:...|:.|        |.:|..|.|.....
Yeast   909 TVVSRKTLIISTEVCSHSKCVPTVITEVVTSKGTPSNGHSSQTLQTEAVEVTLSSHQTVTMSTEV 973

  Fly   596 TTTSTSGPTTTT---------PRSTTTTSTSGPTTT--------TPRSTTTTST-SGP---TTTT 639
            .:.|...||..|         |..|::||:|...:|        :..||.:.|| |.|   |::.
Yeast   974 CSNSICTPTVITSVQMRSTPFPYLTSSTSSSSLASTKKSSLEASSEMSTFSVSTQSLPLAFTSSE 1038

  Fly   640 PRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTS----TSG---PTTTTPR----STTT 693
            .||||:.|....|..|  :|..:|:|...:|..:.::|||    :||   |:::||.    ||.|
Yeast  1039 KRSTTSVSQWSNTVLT--NTIMSSSSNVISTNEKPSSTTSPYNFSSGYSLPSSSTPSQYSLSTAT 1101

  Fly   694 TSTSG----PTTTTPRSTTTT---------------STSGPTTTTPR-------STTTTSTSGPT 732
            |:.:|    .||..|.:..:|               |:|.|:::..:       ||.||:.||..
Yeast  1102 TTINGIKTVYTTWCPLAEKSTVAASSQSSRSVDRFVSSSKPSSSLSQTSIQYTLSTATTTISGLK 1166

  Fly   733 T--TTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTT------- 788
            |  ||....|:.||.|.|      |.|:||:....|:..|.|:||.|..|:|...|::       
Yeast  1167 TVYTTWCPLTSKSTLGAT------TQTSSTAKVRITSASSATSTSISLSTSTESESSSGYLSKGV 1225

  Fly   789 ----------TTSTSGPTTT---TPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTST 840
                      .|.:|.|.:|   :| |.:|:|:|..:|||..:.|:|.||.|...   |:::.|.
Yeast  1226 CSGTECTQDVPTQSSSPASTLAYSP-SVSTSSSSSFSTTTASTLTSTHTSVPLLP---SSSSISA 1286

  Fly   841 SGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTT--------TTPR 897
            |.|::|:..||:..|.:..::|.|.:|..:|::...::.|.|:.::.:..|.:        ::..
Yeast  1287 SSPSSTSLLSTSLPSPAFTSSTLPTATAVSSSTFIASSLPLSSKSSLSLSPVSSSILMSQFSSSS 1351

  Fly   898 STTTTSTSGPTTTTPRSTTTTSTSCPTTTTPRSTTTTCTSGPTTTTPRSTTTTC--TSC----PT 956
            |::::..|.|:.:...:..|.|...|||:.   .|.|||.   :...:..:|.|  ::|    .|
Yeast  1352 SSSSSLASLPSLSISPTVDTVSVLQPTTSI---ATLTCTD---SQCQQEVSTICNGSNCDDVTST 1410

  Fly   957 TTTPRSTTTTCTSCPTTTTPRSTTTTCT--SGPTTTTPRSTTKTSTC------APTTTTPRSTTT 1013
            .|||.||.|...:|..:...::|:::|.  |...:.|.:|:...|.|      |..|:...|...
Yeast  1411 ATTPPSTVTDTMTCTGSECQKTTSSSCDGYSCKVSETYKSSATISACSGEGCQASATSELNSQYV 1475

  Fly  1014 TSTSRPTTTTPRSTTTTTTSRPTTTTPRSTTTPSTSRPTTTTPRST-----TTTSTSR---PTTT 1070
            |.||   ..||.:.|||:....:|   .||.:.:|.:|.|.|...|     |.||:|:   |:.|
Yeast  1476 TMTS---VITPSAITTTSVEVHST---ESTISITTVKPVTYTSSDTNGELITITSSSQTVIPSVT 1534

  Fly  1071 TPRSTTKTSTCAPTTTTPRSTTTTTTSRPTTTTPRSTTTTTTSRPT-TTTPRSTT 1124
            |..:.||.:    .|:.|:.||||...:..:::..:|:....:..| .|||..:|
Yeast  1535 TIITRTKVA----ITSAPKPTTTTYVEQRLSSSGIATSFVAAASSTWITTPIVST 1585



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126579
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.