DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sgs1 and VWF

Sequence 1:NP_523475.3 Gene:Sgs1 FlyBaseID:FBgn0003372 Length:1286 Species:Drosophila melanogaster
Sequence 2:NP_000543.2 Gene:VWF HGNCID:12726 Length:2813 Species:Homo sapiens

Alignment Length:425 Identity:80/426 (19%)
Similarity:112/426 (26%) Gaps:151/426 (35%)


  Fly    14 LIQVKNVKANYDWDSMQDGPSEEIIPGCGGDTIYYPDPVQPCDTDSNPTTTKPRQKTKRPKST-- 76
            |.:|..::.|.|    |..|..|.:  |...:...| ||..|:....||.|.|.:  .||..|  
Human  2306 LCEVARLRQNAD----QCCPEYECV--CDPVSCDLP-PVPHCERGLQPTLTNPGE--CRPNFTCA 2361

  Fly    77 --RRTTKRTKRPRRKTTKWTTKRATKRTTKRTTRRRPTTPKTPDTTDSPITTTGAECTCSDRTTA 139
              :...||...|                 .....|.||..||....:       .||.|:     
Human  2362 CRKEECKRVSPP-----------------SCPPHRLPTLRKTQCCDE-------YECACN----- 2397

  Fly   140 SSTDSTTDRTTVTNTDWTTPL----CTDTPPCTCSEESSTAIPSSPCIDTSTVIPTSPCTQETTT 200
                       ..|:..:.||    .|.|..|.|:  ::|.:|...|:..||:.|.....:|   
Human  2398 -----------CVNSTVSCPLGYLASTATNDCGCT--TTTCLPDKVCVHRSTIYPVGQFWEE--- 2446

  Fly   201 PTPTCSTQGTQTTPCTCAQTTTTPRSTTTTSTS-RPTTTTPRSTTT-------------TTTSRP 251
               .|..       |||...............| :|...:.||..|             .:....
Human  2447 ---GCDV-------CTCTDMEDAVMGLRVAQCSQKPCEDSCRSGFTYVLHEGECCGRCLPSACEV 2501

  Fly   252 TTTTPRSTTTTTTRR---------------------------------PTTTTPRC------TTT 277
            .|.:||..:.::.:.                                 |....|.|      :..
Human  2502 VTGSPRGDSQSSWKSVGSQWASPENPCLINECVRVKEEVFIQQRNVSCPQLEVPVCPSGFQLSCK 2566

  Fly   278 TSTCAPTTTTPRSTTT----------TTTSRPTTTTPRCTTTTSTCSPTRTTPRSTTTTSTSRPT 332
            ||.|.|:....|....          .|......||.||.......|..:...|.||        
Human  2567 TSACCPSCRCERMEACMLNGTVIGPGKTVMIDVCTTCRCMVQVGVISGFKLECRKTT-------- 2623

  Fly   333 TTTPRCTTTPSTSRPTTTTPRSTTKTSTCAPTTTT 367
                 |...|...:....|.....:   |.||..|
Human  2624 -----CNPCPLGYKEENNTGECCGR---CLPTACT 2650

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sgs1NP_523475.3 None
VWFNP_000543.2 VWD 35..179 CDD:278521
C8 222..291 CDD:214843
TIL 295..348 CDD:280072
VWC 350..>394 CDD:302663
VWD 377..540 CDD:214566
C8 580..648 CDD:285899
TIL 652..707 CDD:280072
Amino-terminal 764..787
E1 788..833
CX 826..853
VWD 856..1011 CDD:214566
C8 1053..1127 CDD:214843
TIL 1146..1196 CDD:280072
VWA_N2 1198..1276 CDD:292782
VWA 1277..1449 CDD:214621
VWA 1498..1658 CDD:278519
VWA 1691..1862 CDD:278519
VWD 1950..2102 CDD:278521
C8 2136..2199 CDD:285899
TIL 2203..2254 CDD:280072
E2 2216..2261
VWC 2261..2321 CDD:214564 5/19 (26%)
VWC 2431..2494 CDD:214564 14/76 (18%)
Cell attachment site 2507..2509 1/2 (50%)
VWC 2582..2644 CDD:278520 12/78 (15%)
CT 2727..2808 CDD:214482
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126579
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.