DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sgs1 and MUC6

Sequence 1:NP_523475.3 Gene:Sgs1 FlyBaseID:FBgn0003372 Length:1286 Species:Drosophila melanogaster
Sequence 2:NP_005952.2 Gene:MUC6 HGNCID:7517 Length:2439 Species:Homo sapiens

Alignment Length:1366 Identity:430/1367 (31%)
Similarity:585/1367 (43%) Gaps:289/1367 (21%)


  Fly   127 TGAECTCSDRTTASSTDSTTDRTTVTNTDWTTPL---------------------------CT-D 163
            :|.:|.|.....|:...:..|:...  .||.||.                           || .
Human  1094 SGGDCECLCDAVAAYAQACLDKGVC--VDWRTPAFCPIYCGFYNTHTQDGHGEYQYTQEANCTWH 1156

  Fly   164 TPPCTCSEESSTAIPSS----------------------PCIDTSTVIPTSPCTQETTTP-TPTC 205
            ..||.|..:.. ::|.|                      ||:.     ||:|  |..||| .||.
Human  1157 YQPCLCPSQPQ-SVPGSNIEGCYNCSQDEYFDHEEGVCVPCMP-----PTTP--QPPTTPQLPTT 1213

  Fly   206 STQGTQTTPCTCAQTTT--------------TPRSTT-------TTSTSRPTTTT---PRSTTTT 246
            .::.||..|.|...||.              ||.|.|       |.::|:||.::   ||.||..
Human  1214 GSRPTQVWPMTGTSTTIGLLSSTGPSPSSNHTPASPTQTPLLPATLTSSKPTASSGEPPRPTTAV 1278

  Fly   247 TTSRPTTTTPRSTTTTTTRRPTTTTPRCTTTTSTCAP-TTTTPRSTTTTTTSRPTTTTPRCTTTT 310
            |....:...|.:|..:|..:||.|......|.||.:| ||:|.:|||.||.:.||..|.. |:.|
Human  1279 TPQATSGLPPTATLRSTATKPTVTQATTRATASTASPATTSTAQSTTRTTMTLPTPATSG-TSPT 1342

  Fly   311 STCSPTRTTPRSTTTTSTS-RPTTTTPRCTTTPSTSRPTTTTPRSTTKTSTCAPTTTTPRPTTTP 374
            ...|..:..|.:|.|.:|. |||..:....|||...:||..|...||:|.|....||...|.||.
Human  1343 LPKSTNQELPGTTATQTTGPRPTPASTTGPTTPQPGQPTRPTATETTQTRTTTEYTTPQTPHTTH 1407

  Fly   375 STSRPTTTTPRSTTTTSTSRPTTTTPRSTTTTTTRRPTTTTPRSTTTTSTSRPTTTTP----RST 435
            |.....:..|.:...|:||...|||..:.:...|..||...|.||:..:.|..|..||    .:|
Human  1408 SPPTAGSPVPSTGPVTATSFHATTTYPTPSHPETTLPTHVPPFSTSLVTPSTHTVITPTHAQMAT 1472

  Fly   436 TTTTTSRPTTTTPRSTTTTCTCSPTTTTPRSTTTTSTSR-----PTTTTPRS--TTTTSTSGPTT 493
            :.:..|.||.|.|..||...|.|..|..|.:.||:.||:     .|..||.|  :.|:||..| .
Human  1473 SASNHSAPTGTIPPPTTLKATGSTHTAPPITPTTSGTSQAHSSFSTNKTPTSLHSHTSSTHHP-E 1536

  Fly   494 TTPRSTTTTTTSGPTTT---TPRSTTTTCTCS-----------PTTTTPRSTTTP--STSRPTTT 542
            .||.||||.|.: ||:|   ||.:.|.:.|.|           ||.::|.|:|.|  :||..|||
Human  1537 VTPTSTTTITPN-PTSTRTRTPVAHTNSATSSRPPPPFTTHSPPTGSSPFSSTGPMTATSFKTTT 1600

  Fly   543 TPRSTTTTCTCSPTTTTPRSTTTTSTSRPTTTTP----RSTTTTTTSRPTTTTPRSTTTTSTSGP 603
            |..:.:...|..||...|.||:..:.|..|..||    .:|:.:..|.||.|.|..||..:| |.
Human  1601 TYPTPSHPQTTLPTHVPPFSTSLVTPSTHTVITPTHAQMATSASIHSMPTGTIPPPTTLKAT-GS 1664

  Fly   604 TTTTPRSTTTTS-TSGPTTTTPRSTTTTSTSGPTTTT----PRSTTTTS-TSGPTTT-TPRSTTT 661
            |.|.|..|.||| ||...::...:.|:||....|::|    ..||:||: |..||:| ||..|.|
Human  1665 THTAPTMTLTTSGTSQALSSLNTAKTSTSLHSHTSSTHHAEATSTSTTNITPNPTSTGTPPMTVT 1729

  Fly   662 TS-TSGPTTTTPRSTTTTSTSGPTTTT--PRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRST 723
            || ||...::...:.|:||....|::|  |..|:|::||    .||..|:|      .|.||.:.
Human  1730 TSGTSQSRSSFSTAKTSTSLHSHTSSTHHPEVTSTSTTS----ITPNHTST------GTRTPVAH 1784

  Fly   724 TTTSTSG----PTTT--TPRSTTTTSTSGPTTTTPRSTTTT--STSGPTTTTPRSTTTTSTSGPT 780
            ||::||.    |.||  .|..||..|::||.|.|...||||  :.|.|.||.|....:.|||..|
Human  1785 TTSATSSRLPTPFTTHSPPTGTTPISSTGPVTATSFQTTTTYPTPSHPHTTLPTHVPSFSTSLVT 1849

  Fly   781 ---------TTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPR--S 834
                     |.|..:|:.:..|.||.|.|..||..:| |.|.|.|..|.|||   .|:.:|.  |
Human  1850 PSTHTVIIPTHTQMATSASIHSMPTGTIPPPTTIKAT-GSTHTAPPMTPTTS---GTSQSPSSFS 1910

  Fly   835 TTTTSTSGPTTT--------TPRSTTT-----TSTSGPTTTTPRSTTTTSTSG----PTTT--TP 880
            |..||||.|..|        ||.|||.     |||.   |.||.:.||:::|.    |.||  .|
Human  1911 TAKTSTSLPYHTSSTHHPEVTPTSTTNITPKHTSTG---TRTPVAHTTSASSSRLPTPFTTHSPP 1972

  Fly   881 RSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSCPTTTTPRSTTTTCTSGPTTTTPR 945
            ..::..|::||.|.|...||||.   ||.:.|:  ||..|..|..:|...|.:|.|...||.|..
Human  1973 TGSSPFSSTGPMTATSFQTTTTY---PTPSHPQ--TTLPTHVPPFSTSLVTPSTHTVIITTHTQM 2032

  Fly   946 STTTTCTSCPTTTTPRSTTTTCTSCPTTTTPRSTTTTCTSGPTTTTPRSTTKTSTCAPTTTTPRS 1010
            :|:.:..|.||.|.|..||...|....|..|.:.||:.||...::...:|..:|..:.::..|::
Human  2033 ATSASIHSTPTGTVPPPTTLKATGSTHTAPPMTVTTSGTSQTHSSFSTATASSSFISSSSWLPQN 2097

  Fly  1011 TTTTSTSRPTT---------TTPRSTT-------TTTTSRPTTTT---PRSTTTPSTSRPTTTT- 1055
            :::...|.|.|         |||.|||       :.:.|.|:|.:   |.|.::|.||.|:..| 
Human  2098 SSSRPPSSPITTQLPHLSSATTPVSTTNQLSSSFSPSPSAPSTVSSYVPSSHSSPQTSSPSVGTS 2162

  Fly  1056 ------PRSTTTTSTSRPTTTTPRSTTKTSTCAP-------TTTTPRSTTTTTTSRPTTTT---P 1104
                  |..:||.|:...::.:...||.:.:.:|       .:||.|:|...|.|.|.|.:   |
Human  2163 SSFVSAPVHSTTLSSGSHSSLSTHPTTASVSASPLFPSSPAASTTIRATLPHTISSPFTLSALLP 2227

  Fly  1105 RSTTT---TTTSRPTTTTPRSTTTPCTSRPTTTTPRSTTTTTTSRPTTTTPR----------STT 1156
            .||.|   |.:|...::|....:||.|:..|.|.|..::.:||||.|:.|.|          |..
Human  2228 ISTVTVSPTPSSHLASSTIAFPSTPRTTASTHTAPAFSSQSTTSRSTSLTTRVPTSGFVSLTSGV 2292

  Fly  1157 TPCPTTTPSASPTRTTTTRRPCP--------------CHPQPPYQIPPWSWWYPNPTYPN--PVW 1205
            |..||     ||....|||.|.|              .|...|...|..|...|.||.|.  .|.
Human  2293 TGIPT-----SPVTNLTTRHPGPTLSPTTRFLTSSLTAHGSTPASAPVSSLGTPTPTSPGVCSVR 2352

  Fly  1206 PWQPN-------------------------PVVPQWPQMPGYPNQWPQLPGYPQQLPPPLPSPQW 1245
            ..|..                         .::.|  |:....:....|..|.|||..|.|.|..
Human  2353 EQQEEITFKGCMANVTVTRCEGACISAASFNIITQ--QVDARCSCCRPLHSYEQQLELPCPDPST 2415

  Fly  1246 P 1246
            |
Human  2416 P 2416

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sgs1NP_523475.3 None
MUC6NP_005952.2 VWD 40..192 CDD:214566
C8 228..297 CDD:285899
TIL 302..357 CDD:280072
VWC_out 359..>403 CDD:214565
VWD 386..549 CDD:214566
C8 588..660 CDD:285899
TIL 664..721 CDD:280072
TIL 782..827 CDD:280072
VWC 829..886 CDD:302663
VWD 868..1017 CDD:278521
C8 1057..1127 CDD:285899 9/35 (26%)
1, truncated 1561..1738 65/178 (37%)
Approximate repeats 1607..1953 135/364 (37%)
PHA03255 2188..>2343 CDD:165513 47/160 (29%)
CT 2351..2434 CDD:214482 13/69 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126579
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.