DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sgs1 and asic2

Sequence 1:NP_523475.3 Gene:Sgs1 FlyBaseID:FBgn0003372 Length:1286 Species:Drosophila melanogaster
Sequence 2:XP_005164179.1 Gene:asic2 ZFINID:ZDB-GENE-040513-4 Length:564 Species:Danio rerio

Alignment Length:128 Identity:26/129 (20%)
Similarity:37/129 (29%) Gaps:47/129 (36%)


  Fly    85 RPRRKTTKWT--------TKRATKRTTKRTTRRRPTTPKTPDTTDSPITTT--------G----- 128
            ||......|.        .:.|:....:|..|||.|.|.||....|.:|..        |     
Zfish    16 RPAALAALWALMALEGRCLRPASPTPGQRRARRRHTRPGTPRDDLSRLTVALLSRTRLHGLRHIC 80

  Fly   129 --------------AECTCSDRTTASSTDS-----TTDRTTVTNTDW-------TTPLCTDTP 165
                          |.|||.....:.|::.     .....|..:|:|       |..:|.:.|
Zfish    81 SPSNSLSRRAFWMIAFCTCLGLLLSWSSNRLLHWLAFPTHTRVHTEWAKELAFPTVTICNNNP 143

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sgs1NP_523475.3 None
asic2XP_005164179.1 ASC 71..538 CDD:295594 12/74 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126579
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.