DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sgs1 and Muc6

Sequence 1:NP_523475.3 Gene:Sgs1 FlyBaseID:FBgn0003372 Length:1286 Species:Drosophila melanogaster
Sequence 2:NP_001355882.1 Gene:Muc6 MGIID:2663233 Length:2813 Species:Mus musculus

Alignment Length:1500 Identity:447/1500 (30%)
Similarity:625/1500 (42%) Gaps:349/1500 (23%)


  Fly    49 PDPVQPCDTDSNPTTTKPRQKT----KRPKSTRRTTKRTKR------PRRKTTKWTTKRATKRTT 103
            |.|..|..|:.....|.|::.|    :.|::|...|..|..      |:...|:....:||.:.|
Mouse  1244 PPPSAPSSTEELTVWTTPKESTVSSGEYPQTTMAATPPTSPWPPTSIPKSTPTELPVTQATSKPT 1308

  Fly   104 --KRTTRRRPTTPKTPDTTDSPITTTGAECTCSDRTTASST---DSTTDRTTVTNTDWTTPLCTD 163
              ..::..:.|...|..||.:.:|......|...:|:||.|   .||:...| |.:.|.|...:|
Mouse  1309 ASSLSSSTKTTAELTESTTVTLLTLMPGMSTSQGKTSASYTTQHQSTSFHLT-TISKWPTNGVSD 1372

  Fly   164 T-----------------------------------PPCTCSEESSTAIPSSPCIDTSTVIP--- 190
            |                                   ||...|.:::...|:.....||.|.|   
Mouse  1373 TPGVHTSSGTPSSSHATHITYTPPTQVVSSITHSTGPPLGTSVQTTINFPTLSAPQTSLVTPHPG 1437

  Fly   191 ------------------------TSP----------CTQETTTPTPTCSTQGTQTTPCTCAQTT 221
                                    .||          .|.|.|||..|.....:.|:..|.||::
Mouse  1438 LSSSSTALTSEILKTPTSSQMVSSASPQTIFSSIHPKTTLEATTPQHTAPLITSITSSITQAQSS 1502

  Fly   222 TTPRSTTTTSTSRPTTTT---PRSTTTTTTSRPTT-----TTPRSTTTTTTRRPTTTTPRCTTTT 278
            .:...|.|:..|:|:|.|   .||..|.|||..:|     |.|..||:.||..|  .|||.|...
Mouse  1503 FSTDKTYTSQHSQPSTMTAHQSRSLPTVTTSTKSTMGLTGTPPVHTTSGTTSSP--QTPRTTHPF 1565

  Fly   279 STCAPTTT------TPRSTTTTTTSRPTTTTPRCT-------TTTSTCSPT-----RTTPRST-- 323
            ||.|.:.|      :..::..||.:.||.:.|:.:       ::||:.:||     ..||:.|  
Mouse  1566 STVAVSNTKHTTGVSLETSVQTTIASPTPSAPQTSLATHLPFSSTSSVTPTSEVIITPTPQHTLS 1630

  Fly   324 ---TTTSTSRPTTTTPRCTTTPSTSRPTTTTPRSTTKTSTCAPTTTTPRPTTTPSTSRPTTTTPR 385
               |:|:|.....||...|.:|.||.|...|..:.|:|.|...|..|..||:.|..|..:..|..
Mouse  1631 SASTSTTTGNILPTTIGQTGSPHTSVPVIYTTSAITQTKTSFSTDRTSTPTSAPHLSETSAVTAH 1695

  Fly   386 STTTTSTS----RPT---TTTP----RSTTTTTTRRPTTTTPRSTTTTSTSRPTTTTPRSTTT-T 438
            .:|.|:.|    :||   |.||    .|.||::.:.|.||.|.:|...|.:..||..|..|:. |
Mouse  1696 QSTPTAVSANSIKPTMSSTGTPVVHTTSGTTSSPQTPRTTHPSTTVAVSGTVHTTGLPSGTSVHT 1760

  Fly   439 TTSRPTTTTPRSTT-------TTCTCSPTT------TTPRSTTTTSTSRPT-------------- 476
            ||:.||.:.|:|:.       :|.:.:|||      |:|.|.:..|||.|.              
Mouse  1761 TTNFPTHSGPQSSLSTHLPLFSTLSVTPTTEGLNTPTSPHSLSVASTSMPLMTVLPTTLEGTRPP 1825

  Fly   477 -TTTPRSTTTT----------------------STSGPTTTTPRSTTTT---TTSGPTTTTPRST 515
             |:.|.:.|||                      ||..||.:||...||.   ||.|.|.|.|..|
Mouse  1826 HTSVPVTYTTTAATQTKSSFSTDRTSAPHLSQPSTVTPTQSTPIPATTNSLMTTGGLTGTPPVHT 1890

  Fly   516 TTTCTCSPTTTTPRST---TTPSTSRPTTTTPRSTTT---TCTCSPTTTTPRST-------TTTS 567
            |:..|.||  .|||:|   :|.:.|..|.||..|..|   |...|||.:.|:::       ::||
Mouse  1891 TSGTTSSP--QTPRTTHPFSTVAVSNTTHTTGVSLETSVQTTIASPTPSAPQTSLATHLPFSSTS 1953

  Fly   568 TSRPT-----TTTPRSTTTTTTSRPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRST 627
            :..||     |.||:.|.::.::..||.....||...|..|.|:.|...||::.:...|:.....
Mouse  1954 SVTPTSEVIITPTPQHTLSSASTSTTTGNILPTTIGKTGSPHTSVPVIYTTSAITQTKTSFSTDR 2018

  Fly   628 TTTSTSGP-----TTTTPRSTTTTSTSG----PTTTTPRSTTTTSTSGPTTT--TPRST---TTT 678
            |:||||.|     :..|...:|.|:.|.    ||.::..:....:|||.|::  |||:|   ||.
Mouse  2019 TSTSTSAPHLSETSAVTAHQSTPTAVSANSIKPTMSSTGTPVVHTTSGTTSSPQTPRTTHPSTTV 2083

  Fly   679 STSGPTTTT--PRSTTT-TSTSGPTTTTPRSTTTT-----STSG--PTT------TTPRSTTTTS 727
            :.||...||  |..|:. |:|:.||.:.|:|:.:|     ||..  |||      |:|.|.:..|
Mouse  2084 AVSGTVHTTGLPSGTSVHTTTNFPTHSGPQSSLSTHLPLFSTLSVTPTTEGLNTPTSPHSLSAAS 2148

  Fly   728 TSGP----TTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPT--TTTP---RSTTTTSTSG---PT 780
            ||.|    ..||...|....||.|.|.|..:.|.|.:|..|  |:||   :|:|.|.|..   |.
Mouse  2149 TSMPLMTVLPTTLEGTRPPHTSVPVTYTTTAATQTKSSFSTDRTSTPHLSQSSTVTPTQPTPIPA 2213

  Fly   781 TTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTT----TTPRSTTTTSTSGPTTTTPRSTTTTST- 840
            ||....||...|..|...||..|::.:.:..||    |...|:||.||:....|:.:||||..| 
Mouse  2214 TTNSPMTTVGLTGTPVVHTPSGTSSIAHTPHTTHSLPTAASSSTTLSTAPQFRTSEQSTTTFPTP 2278

  Fly   841 SGP-----TTTTPRSTTTTSTSGP---TTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPR 897
            |.|     |:..|.||::.|.:..   |:|.|.:.::.|.|.|.:|. ..||...|:.|.|:|| 
Mouse  2279 SAPQTSLVTSLPPFSTSSVSPTDEIHITSTNPHTVSSVSMSRPVSTI-LQTTIEVTTPPNTSTP- 2341

  Fly   898 STTTTSTSGPTTTTPRSTTTTSTSCPTTTTPRSTTT-TCTSGPTTTTPRSTTTTCTSCPTTTTPR 961
              .|.|||. ||....|.:|..||....:.|.|||. ..|:||..|:.:||.....:.|..||  
Mouse  2342 --VTHSTSA-TTEAQGSFSTERTSTSYLSHPSSTTVHQSTAGPVITSIKSTMGVTGTPPVHTT-- 2401

  Fly   962 STTTTCTSCPTTTTPRSTT----TTCTSGPTTTTPRSTTKT-------STCAPTTTTPRSTTTTS 1015
            |.||:....|.:|.|.||.    ||..||....||..||.|       .|...|...|.||:..|
Mouse  2402 SGTTSSPQTPHSTHPISTAAISRTTGISGTPFRTPMKTTITFPTPSSLQTSMATLFPPFSTSVMS 2466

  Fly  1016 TSR--PTTTTPRSTTTTTTSRPTT----TTPRSTTTPSTSRPTTTTPRSTTTTSTSRPTTTT--- 1071
            ::.  .|.|.|.|.::.:||||.:    ||.:.|.||.|......|..:||...:|.|||.|   
Mouse  2467 STEIFNTPTNPHSVSSASTSRPLSTSLPTTIKGTGTPQTPVSDINTTSATTQAHSSFPTTRTSTS 2531

  Fly  1072 ----PRSTTKTSTCA-------------------PTTTTPRSTTTTTTSRPTTTTPRSTTT---- 1109
                |.|.|.|.|.|                   |..|||  |.:..:|.||..:|.:.:|    
Mouse  2532 HLSLPSSMTSTLTPASRSASTLQYTPTPSSVSHSPLLTTP--TASPPSSAPTFVSPTAASTVISS 2594

  Fly  1110 ---------TTTSRPTTTTPRSTTTPCTSRPTTTTPRSTTTTTTSRPTTTTPRST-----TTPCP 1160
                     |.:||||::|...:|:..||...|.:..|:.:||....:.||..:|     :|...
Mouse  2595 ALPTIHMTPTPSSRPTSSTGLLSTSKTTSHVPTFSSFSSKSTTAHLTSLTTQAATSGLLSSTMGM 2659

  Fly  1161 TTTPSA-SPTRTTTTRRPCPCHPQPPYQIP-PWSWWYPNPTYP-------NPVWPWQPNPVVPQW 1216
            |..||: ||....|||        ||...| |.|.:....|.|       .||....|:..|...
Mouse  2660 TNLPSSGSPDINHTTR--------PPGSSPLPTSAFLSRSTSPTGSSSPSTPVSSSNPDSSVSSP 2716

  Fly  1217 PQMPG 1221
            |..||
Mouse  2717 PSHPG 2721

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sgs1NP_523475.3 None
Muc6NP_001355882.1 VWD 45..194 CDD:306577
C8 232..298 CDD:337178
TIL 303..358 CDD:334697
VWC_out 360..>404 CDD:214565
VWD 387..550 CDD:214566
C8 589..661 CDD:214843
TIL 665..722 CDD:334697
TIL 765..828 CDD:334697
VWC 830..887 CDD:327433
VWD 869..1020 CDD:306577
C8 1057..1129 CDD:214843
ROM1 1406..>1624 CDD:227709 57/220 (26%)
Herpes_BLLF1 <1553..1968 CDD:282904 129/419 (31%)
Herpes_BLLF1 <1895..2353 CDD:282904 155/465 (33%)
PHA03247 <2202..2624 CDD:223021 141/431 (33%)
CT 2729..2808 CDD:214482
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126579
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.