DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sgs1 and dpy

Sequence 1:NP_523475.3 Gene:Sgs1 FlyBaseID:FBgn0003372 Length:1286 Species:Drosophila melanogaster
Sequence 2:NP_001260032.1 Gene:dpy FlyBaseID:FBgn0053196 Length:22949 Species:Drosophila melanogaster

Alignment Length:1720 Identity:525/1721 (31%)
Similarity:677/1721 (39%) Gaps:520/1721 (30%)


  Fly    33 PSEE-----IIPGCGGDTIYYPDPVQPCDTDSNPTTTKP-RQKTKRPKSTRRT------------ 79
            |||.     .:|   .|.|..|...|..::..:..||:| ...|..|.|.:.|            
  Fly  5983 PSESPETPTTLP---SDFITRPHSEQTTESTRDVPTTRPFEASTPSPASLKTTVPSVTSEATTNV 6044

  Fly    80 ----------TKRTKRPRRKTT---KWTTKRATKRTTKRTTRRRPTT----PKTPD--------- 118
                      |..::.|...||   .:||:..:::||: :||..|||    ..||.         
  Fly  6045 PIGSTGQRIGTTPSESPETPTTLPSDFTTRPHSEKTTE-STRDVPTTRPFETSTPSPASLETTVP 6108

  Fly   119 ------TTDSPITTTGAECT------------------------CSDRTTASSTDST----TDRT 149
                  ||:.||.:||.:.|                        .:||||.|.:..|    :|.|
  Fly  6109 SVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTLPSDFT 6173

  Fly   150 TVTNTDWTTPLCTDTPPCTCSEESSTAIPSSPCIDTSTVIPTSPCTQETTTPTPTCSTQGTQTTP 214
            |..:::.||....|. |.|...|:||..|:|    ..|.:|:  .|.||||..|..||.|..|  
  Fly  6174 TRPHSEQTTESTRDV-PTTRPFEASTPSPAS----LETTVPS--VTSETTTNVPIGSTGGQVT-- 6229

  Fly   215 CTCAQTTTTPRSTTTT----STSRPTTTTPRSTTTTTTSRPTT------TTPRS-TTTTTTRRPT 268
               .|||..|....||    .::.|:.:|.|::.:.:...|||      |.|.| .||.:||...
  Fly  6230 ---GQTTAPPSEVRTTIGVEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSEQTTESTRDVP 6291

  Fly   269 TTTPRCTTTTSTCAPTTTTPRSTTTTTTSRPTTTTPRCTT--TTSTCSPTRTTPRSTTTTSTSRP 331
            ||.|...:|.|..:..||.|..|:..||:.|..:|....|  |||:.|..|||.|...:|..||.
  Fly  6292 TTRPFEASTPSPASLKTTVPSVTSEATTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRS 6356

  Fly   332 T-TTTPRCTTTPSTSRPT--TTTPRS--TTKTSTCAPTTTTPRPTTTPSTSRPTTTTPRSTTTTS 391
            | .|||..:....|:.|:  ||.|.|  ||:::...| ||.|..|:|||.:...||.|..|..|:
  Fly  6357 TDRTTPSESPETPTTLPSDFTTRPHSEKTTESTRDVP-TTRPFETSTPSPASLETTVPSVTLETT 6420

  Fly   392 TSRP----------TTTTPRSTTTTTTRRPTTTTP-RSTTTTSTSR----PTT------TTPRST 435
            ||.|          .||.|.|...||.|...:|.| |||..||.|.    |||      |.|.|.
  Fly  6421 TSVPMGSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSE 6485

  Fly   436 TTTTTSR--PTT-----TTPRSTTTTCTCS-----------------------------PT---- 460
            .||.::|  |||     :||.|.::...||                             ||    
  Fly  6486 KTTESTRDVPTTRPFEASTPSSASSGNNCSISYFRNHYKCSNRFNRSADRTTPSESPETPTLPSD 6550

  Fly   461 -TTTPRSTTTTSTSRPT-TTTPRSTTTTSTSGPTTTTPRSTTTTTTSGPTTTTPRSTTTTCTCSP 523
             ||.|.|..||.::|.. ||.|...:|.|.:...||.|..|:.|||:.|..:|....|...|..|
  Fly  6551 FTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPP 6615

  Fly   524 ----TTTTPRSTTTPSTSRPTTTTPRSTTTTCTCSPT--TTTPRSTTTTSTSR--PTT-----TT 575
                ||.....:|.||.| ...|||..:..|.|..|:  ||.|.|..||.::|  |||     :|
  Fly  6616 SEVRTTIRVEESTLPSRS-TDRTTPSESPETPTILPSDFTTRPHSDQTTESTRDVPTTRPFEAST 6679

  Fly   576 PRSTTTTT-----TSRPTTTTPRSTTTTSTSGPTTTTPRSTTTT----STSGPTTTTPRSTTTTS 631
            ||..|..|     |...||..|..:|....:|.||.||....||    .::.|:.:|.|:|.:.|
  Fly  6680 PRPVTLETAVPSVTLETTTNVPIGSTGGQVTGQTTATPSEVRTTIRVEESTLPSRSTDRTTPSES 6744

  Fly   632 TSGPT------TTTPRS-TTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPR 689
            ...||      ||.|.| .||.||....||.|...:|.|.:...||.|..|:.|:|:.|..:|..
  Fly  6745 PETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGG 6809

  Fly   690 STTTTSTSGPT----------TTTP-RSTTTTSTS----GPTT------TTPRS-TTTTSTSGPT 732
            ..|..:||.|:          :|.| |||..||.|    .|||      |.|.| .||.||....
  Fly  6810 QVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSDQTTESTRDVP 6874

  Fly   733 TTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPT----------TTTP-RS 786
            ||.|...:|.|.:...||.|..|:.|:|:.|..:|....|..:||.|:          :|.| ||
  Fly  6875 TTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRS 6939

  Fly   787 TTTTSTS----GPTT------TTPRS-TTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTST 840
            |..||.|    .|||      |.|.| .||.||....||.|...:|.|::...||.|..|..|:|
  Fly  6940 TDRTSPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTT 7004

  Fly   841 SGP-----------TTTTPRSTTTT----STSGPTTTTPRSTTTTSTSGPT------TTTPRSTT 884
            :.|           ||::|....||    .::.|:.:|.|:|.:.|...||      ||.|.|..
  Fly  7005 NVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQ 7069

  Fly   885 TTSTSG--PTT-----TTPR------------STTTT-----STSG----PTTTTPRSTTTT--- 918
            ||.:|.  |||     :|||            |.|||     ||.|    .||::|....||   
  Fly  7070 TTESSRDVPTTQPFEASTPRPVTLQTAVLPVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRV 7134

  Fly   919 -STSCPTTTTPRSTTTTCTSGPT------TTTPRSTTTTCTS--CPTT-----TTPRS------- 962
             .::.|:.:|.|:|.:.....||      ||.|.|..||.:|  .|||     :|||.       
  Fly  7135 EESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFESSTPRPVTLETAV 7199

  Fly   963 ---TTTTCTSCP-----------TTTTPRSTTTTCTSGPTT--------TTPRSTTKTSTCAPT- 1004
               |:.|.|:.|           ||.:|....||.....:|        |||..:.:|.|..|: 
  Fly  7200 PPVTSETTTNVPIGSTGGQVTEQTTPSPSEVRTTIRIEESTFPSRSTDRTTPSESPETPTTLPSD 7264

  Fly  1005 -TTTPRSTTTTSTSR--PTT-----TTPR------------STTTT--------------TTSRP 1035
             ||.|.|..||.::|  |||     :|||            |.|||              |||.|
  Fly  7265 FTTRPHSDQTTESTRDVPTTRPFESSTPRPVTLEIAVPPVTSETTTNVAIGSTGGQVTEQTTSSP 7329

  Fly  1036 T----------TTTP-RST--TTPSTSRPT--------TTTPRSTTTTSTSR--PT--------- 1068
            :          :|.| |||  ||||.|..|        ||.|.|..||.::|  ||         
  Fly  7330 SEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTP 7394

  Fly  1069 ------TTTPRSTTKTSTCAP----------TTTTPRSTTTTT------------TSR------- 1098
                  ||.|..|.:|:|..|          .||.|.|...||            |.|       
  Fly  7395 SPASLETTVPSVTLETTTSVPMGSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTPPSESP 7459

  Fly  1099 --PT------TTTPRSTTTTTTSR--PTT-----TTPRSTT-----TPCTSRPTTTTPRSTTTTT 1143
              ||      ||.|.|..||.:||  |||     :|||..|     .|.||..||..|..:|...
  Fly  7460 ETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFESSTPRPVTLEIAVPPVTSETTTNVPIGSTGGQ 7524

  Fly  1144 TSRPTTTTP----------------RST--TTP-----CPTTTPSASPTR-----TTTTRRPCPC 1180
            .:..||.||                |||  |||     .|||.||...||     ||.:.|..| 
  Fly  7525 VTGQTTATPSEVRTTIGVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVP- 7588

  Fly  1181 HPQPPYQIPPWSWWYPNP-----TYPNPVWPWQPN-PVVPQWPQMPGYPNQWPQ----------- 1228
                  ...|:....|:|     |.|:.......| |:.....|:.|.....|.           
  Fly  7589 ------TTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTGQTTATPSEVRTTIGVEES 7647

  Fly  1229 -LPGYPQQLPPPLPSPQWPWSWPKPPVVQP 1257
             ||........|..||:.|.:.|.....:|
  Fly  7648 TLPSRSTDRTTPSESPETPTTLPSDFTTRP 7677

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sgs1NP_523475.3 None
dpyNP_001260032.1 EGF_3 137..166 CDD:289699
EGF_CA 212..247 CDD:238011
EGF_CA 255..>286 CDD:214542
EGF_CA 298..331 CDD:238011
EGF_CA 338..373 CDD:238011
EGF_CA 413..456 CDD:238011
EGF_CA 457..490 CDD:238011
EGF_CA 497..>529 CDD:214542
EGF_CA 580..>612 CDD:214542
EGF_3 676..702 CDD:289699
EGF_CA 1022..1056 CDD:214542
EGF_CA 2227..2260 CDD:238011
EGF_CA 2393..>2422 CDD:214542
DUF4758 4088..4282 CDD:292572
DUF4696 4127..4678 CDD:292395
DUF4758 4275..4448 CDD:292572
DUF4758 4377..4574 CDD:292572
DUF4758 4581..4754 CDD:292572
DUF4758 4683..4847 CDD:292572
DUF4758 4785..4964 CDD:292572
DUF4696 4841..5385 CDD:292395
DUF4758 4887..5098 CDD:292572
DUF4758 5193..5371 CDD:292572
DUF4758 5294..5487 CDD:292572
DUF4758 5445..5650 CDD:292572
DUF4758 5700..5877 CDD:292572
DUF4696 5756..6396 CDD:292395 127/430 (30%)
DUF4758 5802..5979 CDD:292572
DUF4758 5964..6171 CDD:292572 43/192 (22%)
DUF4758 6181..6360 CDD:292572 67/191 (35%)
DUF4696 6339..6999 CDD:292395 226/662 (34%)
DUF4758 6662..6839 CDD:292572 60/177 (34%)
DUF4758 6764..6941 CDD:292572 61/177 (34%)
DUF4758 6866..7045 CDD:292572 59/179 (33%)
DUF4758 6968..7179 CDD:292572 66/211 (31%)
DUF4696 7024..7569 CDD:292395 163/545 (30%)
DUF4758 7172..7383 CDD:292572 64/211 (30%)
DUF4696 7330..7964 CDD:292395 98/356 (28%)
DUF4758 7400..7587 CDD:292572 59/187 (32%)
DUF4758 7538..7707 CDD:292572 35/148 (24%)
DUF4758 7798..7979 CDD:292572
DUF4758 7946..8126 CDD:292572
YppG 18767..>18832 CDD:290883
Med25_SD1 18795..18955 CDD:288132
MISS 19026..19258 CDD:292450
ZP 22576..22811 CDD:214579
Zona_pellucida <22714..22810 CDD:278526
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126579
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.