DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sgs1 and dpy-6

Sequence 1:NP_523475.3 Gene:Sgs1 FlyBaseID:FBgn0003372 Length:1286 Species:Drosophila melanogaster
Sequence 2:NP_509435.2 Gene:dpy-6 WormBaseID:WBGene00001068 Length:1254 Species:Caenorhabditis elegans

Alignment Length:1102 Identity:345/1103 (31%)
Similarity:464/1103 (42%) Gaps:187/1103 (17%)


  Fly   167 CTCSEESSTAIPSSPCIDTSTVIPTSPCTQETTTPT----PTCSTQGTQTTPCTCAQTTTTPRS- 226
            ||||.:.....||:| .|.||.|.:.........|:    ||.|:...:.......||..:..: 
 Worm    47 CTCSCKCVPDAPSNP-FDVSTTISSINNDNVDIGPSGDSNPTGSSWFQEIEATVGGQTVKSEHNI 110

  Fly   227 -TTTTSTSRPTTTTPRSTTTTTTSRPTTTTPRSTT---TTTTRRPTTTTPRCTTTTSTCAPTT-- 285
             ::.....:.||:|..|||...|:...:|||...|   ...::..:.|....|..::|.:|||  
 Worm   111 DSSVEVEKKVTTSTDASTTNAPTTGKDSTTPEIITGIVVINSKSESVTDMSTTRFSTTLSPTTEL 175

  Fly   286 -TTPRSTTTTTTSRPTTTTPRCTTTTSTCSPTRTT----PRSTTTTSTSRPTTTTPRCTTTPSTS 345
             |:|.:..:|.:|          |:|...||..||    |..|.||:.:..|:..|..:|..|..
 Worm   176 LTSPETLVSTDSS----------TSTEQTSPDNTTEIASPMETNTTTEATTTSVEPSVSTLASED 230

  Fly   346 RPTTTTPRSTTKTSTCAPTTTTPRPTTTPSTSRPTTTTPRSTT--TTSTSRPTTTTPRSTTTTTT 408
            ..|.|....:|.|.....:|||..||||..     :||.:|||  ..:|..||.||....|||..
 Worm   231 ETTVTAIAESTTTVIAEVSTTTEEPTTTAE-----STTKKSTTKAPATTEEPTPTTTEEVTTTEA 290

  Fly   409 RRPTTTTPRSTTTTSTSRPTTTTPRSTTTTTTSRPTTTTPRSTTTTCTCSPTT-TTPRSTTTTST 472
            ...|||    ::.|||.:|||    .......:.|.|..|.:|.     .|.| |||...|.|.|
 Worm   291 ETSTTT----SSETSTEKPTT----PLIDNKIAGPATGKPETTH-----FPVTGTTPNFDTATET 342

  Fly   473 SRPTTTTPRSTTTTSTSGPTTTTPRSTTTTTTSGPTTTTPRSTTTTCTCSPTTTTPRSTTTPSTS 537
              |.........|.|.:..|.||.:  ||..|.||...|.::.:...   |.||.|...||.:||
 Worm   343 --PFVAKSEDKMTLSKTAATETTQQ--TTEVTDGPEKETTKNVSIEI---PITTVPLVETTSTTS 400

  Fly   538 RPTTTTPRSTTTTCTCSPTTTTPRSTTTTSTSRPTTTTPRSTTTTTTSRPTTTTPRSTTTTSTSG 602
               |.:..|.....|.....||..|.:|.|.   ||..|.:..|||.|.   ..|:.|    ..|
 Worm   401 ---TASKESDGFHTTLKLKVTTADSDSTESA---TTVKPFNEETTTKSH---VVPKPT----KKG 452

  Fly   603 PTTTTPR-----STTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSG--PTTTTPRSTT 660
            ....||:     ...|..|..|....||.||||:||..|||.....|..||:.  |||:...|||
 Worm   453 TVKVTPKLELSFDEPTEITKAPHPVKPRKTTTTTTSTTTTTEKPVITEGSTTNKQPTTSEHESTT 517

  Fly   661 --TTSTSGPTTTTPRSTT--TTSTSGPTTTTPRSTTTTSTSGPTTTTPRST-TTTSTSGPTTTTP 720
              .|:|..|||||.:..|  ..:|..||||...|||...|   ||..|.:| ...:|..||||..
 Worm   518 EVPTTTEEPTTTTGQHKTEKAITTEEPTTTEESSTTEEVT---TTEEPANTGNPPTTENPTTTEQ 579

  Fly   721 RSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPR 785
            .::|..||   ||..|.:|..|.|:...||..:||.|..    .|||..|.:|..||    ||.:
 Worm   580 PTSTAEST---TTALPFTTEQTVTTEEPTTAEKSTATQK----PTTTQESVSTEKTS----TTKK 633

  Fly   786 STTT---TSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTT----STSGPTTTTPRSTT---TTST 840
            ::||   |:|..|||||..|||..:|:...:||...||||    :|.|.|||...:||   ..::
 Worm   634 ASTTEEPTTTDEPTTTTESSTTGKATTPELSTTSEETTTTELKITTEGSTTTEEPTTTAIFAEAS 698

  Fly   841 SGPTTTTPRSTTTTSTSGPTTTTPR-----STTTTSTSGPTTTTPR------------------- 881
            :|..||...:|:||||:...|:|..     :.|.||.|...::|||                   
 Worm   699 TGIITTDEETTSTTSTTPEITSTKEIVTESAITQTSVSVVESSTPRQLPERWKAIVNKFKHNLEV 763

  Fly   882 ------------STTTTSTSGPTTTTP-----RSTTTTSTSGPTTTTPRSTTTTSTSCPTTTTPR 929
                        ||:||.:....|||.     ...|||.......|||.:|..::|...||||  
 Worm   764 LKEKKRLLKEKESTSTTGSDSSETTTVVAENIDEVTTTEKEKVVQTTPITTEKSTTQEETTTT-- 826

  Fly   930 STTTTCTSGPTTTTPRSTTTTCTSCPTTTTPRSTTTTCTSCPTTTTPRSTTTTCTSGPTTTTPRS 994
                      ||||.::|:.|.|..| ||:..:||.|.||.|:||   .:||..||..|      
 Worm   827 ----------TTTTEKTTSKTTTEKP-TTSESATTETTTSEPSTT---ESTTVDTSSAT------ 871

  Fly   995 TTKTSTCAPTTTTPRSTTTTSTSRP----TTTTPRSTTTTTTSRPTTTTPRSTTTPSTSR----- 1050
            |.::||.|.||||...|:.|:||..    |..:|.:|...::|:.:.....|...|...|     
 Worm   872 TEESSTAAETTTTSAETSETTTSESAAFITGESPENTALQSSSQKSEENESSAEKPGARRDFVPK 936

  Fly  1051 --PTTTTPRSTTTTSTSRPTTTTPRSTTKTSTCAPTTTTPRSTTTTTTSRPTTTTPRSTTTTTTS 1113
              .||..|..||:...:..|||.|.:||:.||...||.. .:||....:.|...|......||.:
 Worm   937 KHKTTVKPAETTSAVAASTTTTEPITTTEKSTTLETTPI-EATTLNEVTGPAFVTGAPVDETTIN 1000

  Fly  1114 RPTTTTPRSTTTPCTSRPTTTTPRSTTTTT--------TSRPTTTTPRSTTTPCPTTTPSAS 1167
            .....:..:.|.....:||..:.....::.        |..|...|..:||.....|...||
 Worm  1001 TLELLSKINNTQISQPKPTDISKTDALSSLISGLIGSFTKAPMAPTIHTTTDAAFVTATEAS 1062

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sgs1NP_523475.3 None
dpy-6NP_509435.2 GBP_C <1089..1182 CDD:303769
coiled coil 1157..1166 CDD:293879
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126579
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.