DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sgs1 and H43E16.1

Sequence 1:NP_523475.3 Gene:Sgs1 FlyBaseID:FBgn0003372 Length:1286 Species:Drosophila melanogaster
Sequence 2:NP_495358.1 Gene:H43E16.1 WormBaseID:WBGene00019273 Length:1203 Species:Caenorhabditis elegans

Alignment Length:994 Identity:271/995 (27%)
Similarity:448/995 (45%) Gaps:168/995 (17%)


  Fly   111 PTTPKTPDTTDSPITTTGAECT-----------CSDRTTASSTDSTTDRTTVTNTDWTTPLCTDT 164
            |...|.....:..|::|.|:.|           .|..||.|...:.:|   ..:.:.|.|.|..|
 Worm   131 PNGDKVIAIGNGAISSTAAQATIPSDQKVKEVITSQNTTYSDVKTASD---ACDKNITLPECPAT 192

  Fly   165 PPC-TCSEESSTAI------------------PSSPCIDTSTVIPTSPCTQETTTPTPTCST--- 207
            |.| |.|.:.:|.:                  |:|.....:....:...||...:...|.|:   
 Worm   193 PTCPTQSSQCNTNLFAISTGINNMVWNVDYSNPNSDAYKNAVQNISDSLTQSLISGLNTASSLYR 257

  Fly   208 ------------------QGTQTTPCTCAQTTTTPRSTTTTSTSRPTTTTPRS--TTTTTTSRPT 252
                              ||:............   |:|:...:.||.....|  |:..:|....
 Worm   258 ILAAMPSNNIQVQISALRQGSDNMVVAIGNGAI---SSTSDLGTMPTDQNVNSVITSDNSTYSDV 319

  Fly   253 TTTPRSTTTTTTRRPTTTTPRCTTTTS-TCAPTTTTPRSTTTTTTSRPTTTTPRCTTTTSTCSPT 316
            .|.|::......:   |..|.|:|... .|...::.|.||...||:.|.||    ..||.|...|
 Worm   320 HTAPQACNKNIIQ---TDCPVCSTAAPVVCTTASSAPASTAVVTTTMPVTT----VQTTVTSIGT 377

  Fly   317 RTTPRSTTTTSTSRPTTTTPRCTTTPSTSRPTTTTPRSTTKTSTCAPTTTTPRPTTTPSTSRPTT 381
            .|:|::..|| |..||||...     |:|..|.|    :|:|:..:|:|.:   .|||..|..:|
 Worm   378 STSPQAVVTT-TGNPTTTAQL-----SSSSKTLT----STQTTQGSPSTVS---QTTPGVSSAST 429

  Fly   382 -TTPRSTTTTSTSRPTTTTPRSTTTTTTRRPT-TTTPRSTTTTSTSRPTTTTPRSTTTTTTSRPT 444
             .|....:..||....|:||.|.|.|:|  || |:|..:..::|::.||:|...|::|.||...:
 Worm   430 GMTTSQASLRSTQNSVTSTPGSFTVTST--PTITSTQGAMASSSSNSPTSTQAISSSTVTTVASS 492

  Fly   445 TTTPRSTTTTCTCSPTTTTPRSTTTTSTSRPTTTTPRSTTTTSTSGPTT---TTPRSTTTTTTSG 506
            |..|.|:..:.:.:.::...:|||..:.|  ||.|..|..:|||.|.|.   ::..|:|..||.|
 Worm   493 TIAPTSSQESSSIASSSAPSQSTTVITVS--TTATVSSGQSTSTFGTTIGQGSSFGSSTIQTTQG 555

  Fly   507 PTTTTPRSTTTTCTCSPTTTTPRSTTTPSTSRPTTTTPRSTTTTCTCSPTTTTPRSTTTTSTSRP 571
            .::..|                    .|||:..::.||.|.::|     .||..:.:::...:.|
 Worm   556 TSSFAP--------------------IPSTAGSSSQTPGSMSST-----GTTVGQMSSSFQPTAP 595

  Fly   572 TTTTPRSTTTTTTSRPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPT 636
            |:.....||..|:|.|:.:| ...:.:||.|.|.|...|::|:....|:.:|..|   |.||.|.
 Worm   596 TSLGTIMTTPGTSSIPSIST-SVNSGSSTIGSTVTQAPSSSTSMGPSPSQSTAGS---TMTSAPP 656

  Fly   637 TTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTT 701
            .|:..|..|.|||..||.:.::|..:||:.|..::....|:|.....::::..||....:|..||
 Worm   657 VTSSSSANTGSTSSGTTVSVQTTQVSSTTSPVASSSSQMTSTQQPSGSSSSIGSTVNQGSSSVTT 721

  Fly   702 TTPRSTTTTSTSGPTTTTP--RSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPT 764
            ..|.|:.:|::.|.::..|  .|:|..||:|.::..|.:::|:..|....|:..||..:||.|.|
 Worm   722 QPPASSRSTASQGSSSAQPIASSSTMGSTAGSSSPQPTASSTSVPSSTGATSSGSTVGSSTMGST 786

  Fly   765 TTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTT----TSTSGPTTTTPRSTTTTSTS 825
            .::..|:|.|:|....:|......::||.|.::|.|.:::|    :||||.|..|.:.:::|.|:
 Worm   787 QSSLPSSTMTNTGSTGSTVTNQLASSSTYGASSTEPIASSTANPGSSTSGQTAVTTQGSSSTQTN 851

  Fly   826 GPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTT----TSTSGPTTTTPRSTTTT 886
                      :.|.::|.|.|.|  ..::||||.::|.|.:::|    :||||.|..|.:.:::|
 Worm   852 ----------SNTGSTGSTVTNP--PVSSSTSGSSSTQPIASSTANPGSSTSGTTVVTTQGSSST 904

  Fly   887 STSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSCPTTTTPRSTTT---TCTSGPTTTTPRSTT 948
            .|:          ..|.::|.|.|.|.:.::||.|..|.....|||.   :.|||||..:.:.::
 Worm   905 QTN----------PNTGSTGSTVTQPSAFSSTSASSSTQPIASSTTANPGSSTSGPTIASTQGSS 959

  Fly   949 TTCTSCPTTTTPRSTTTTCTSCPTTTTPRSTTTTCTSGPTTTTPRSTTKTSTCAPTTTTPRSTTT 1013
            :|.|:..|.:|..:||.|          :.::|...:|.||...:|::..||.|.:|    |...
 Worm   960 STQTNSNTGSTTVATTVT----------QGSSTEGNTGSTTVNSQSSSVASTVASST----SNIV 1010

  Fly  1014 TSTSR-PTTTTPRSTTTTT 1031
            :|||: ||..:|.|....|
 Worm  1011 SSTSQAPTCASPYSGKIAT 1029

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sgs1NP_523475.3 None
H43E16.1NP_495358.1 rad2 <76..>260 CDD:273166 26/132 (20%)
PHA03307 556..>908 CDD:223039 110/403 (27%)
FSA_C <933..1022 CDD:287455 30/103 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126579
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.