DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sgs1 and Muc4

Sequence 1:NP_523475.3 Gene:Sgs1 FlyBaseID:FBgn0003372 Length:1286 Species:Drosophila melanogaster
Sequence 2:NP_536705.3 Gene:Muc4 MGIID:2153525 Length:3470 Species:Mus musculus

Alignment Length:1433 Identity:471/1434 (33%)
Similarity:636/1434 (44%) Gaps:339/1434 (24%)


  Fly    57 TDSNPTTTKPRQKTKRPKSTRRTTKRTKRPRRKTTKWTTKRATKRTTK-----RTTRRRPTTPKT 116
            |:...|...|...|...:|...|:..|.:|:..||...|......:::     .|:.:|..:|..
Mouse    65 TEQTSTRDTPSSITTVSQSHHTTSMETSKPQTTTTTEVTTSTPSASSRDQIQTETSSQRTISPDG 129

  Fly   117 PDTTDSPITTTGAECTCSDRTTASSTDST---TDRTTVTNTDWTTPLCTDTPPCTCSEESSTAIP 178
            ..|:.:|..::.|..|....||.|||:||   :..||...|...||        ..::.|.|  |
Mouse   130 TTTSHAPSISSSAPSTTHMLTTTSSTESTSVDSGHTTAITTQGLTP--------ATAQVSLT--P 184

  Fly   179 SSPCIDTSTVIPTSPCTQETTT-------------PTPTCSTQGTQTTPC-TCAQTTT-----TP 224
            ||..:.|.:...||..||...|             .|.|.||..:.:||. |.:|.|:     |.
Mouse   185 SSQNMSTVSTPITSTLTQRQHTGSKQTSSKSQVNIVTSTLSTSTSDSTPAQTMSQVTSSSDKRTK 249

  Fly   225 RSTTTTSTSRPTTTTPRSTTTTTTSRPTTTTPRST---TTTTTRRPTTTTPRCTTTTSTC----- 281
            .||:..|::..|||...:.|::|.|.|..||.|.|   ||.||:..||:||:..:..||.     
Mouse   250 PSTSGVSSTSLTTTEVLTQTSSTDSAPGNTTLRITQNSTTHTTKVSTTSTPQKLSPVSTLINSSQ 314

  Fly   282 ----------APTTTTPRSTTTTTTSRPTTTTPRCTT----TTSTCSPTRTTPRSTTTT------ 326
                      ..:..|.|...||||...||:||..::    .|.|.||...:|..|||:      
Mouse   315 KMSTLPQNQHTESMDTSRQPQTTTTIEVTTSTPSASSLHQIQTETNSPKTISPGETTTSHAPNMR 379

  Fly   327 ----STSRPTTTTPRCTTTPSTSRPTTTTPRSTTKTSTCAPTTT----TPR----PTTTPSTSRP 379
                .||:..||.|   :|.|||..|..|...|||.||  |.||    ||.    ||.:.||...
Mouse   380 SSPPKTSQILTTMP---STKSTSVDTKQTKAITTKVST--PDTTQVSMTPSSQKLPTHSTSTQEL 439

  Fly   380 TT----------TTPRSTTTTSTSRPTTTTP----RSTTTTTTRRPTTTTPRSTTTT-----STS 425
            |:          |:.:|.|||:| :..|:||    |....|.|....|.:|....|:     |:|
Mouse   440 TSSYSQHIQSKGTSSKSQTTTNT-KVNTSTPSASSRDKIQTETSSQRTNSPGEKRTSHAPSMSSS 503

  Fly   426 RPTTTTPRSTTTTT------TSRPTTTTPRSTTTTCTCSPTTTTPRSTTTTSTSRPTTTTPRSTT 484
            .|:||...|||::.      |.:.|:.|.:.:|...|  .|:.||.|..|::.|.|.|:|.:.:|
Mouse   504 APSTTHMLSTTSSNQSTSVDTGQTTSVTAQGSTPAIT--QTSLTPSSQNTSTVSTPITSTHKLST 566

  Fly   485 TTST----SGPTTTTPRSTTTTTTSGPTTTTPRSTT----TTCTCSPTTTTPRSTTTP-----ST 536
            .:.:    |..|::.|::||||..   ||:||.:||    .|.|.|..|.:|..|||.     |:
Mouse   567 LSQSQHTGSKGTSSNPQTTTTTEV---TTSTPSATTHDQIQTETSSQNTISPGETTTSYAPIMSS 628

  Fly   537 SRPTTTTPRSTTTTCTCSPTTTTPRSTTTTSTSRPTTT--TPRSTTTTTTSRPTTTT------PR 593
            |.|:||...|||::...:...|...:|.|...|.|.||  :|.|...:|.|.|.|:|      |:
Mouse   629 SAPSTTHMLSTTSSTQSTSVDTRHTTTLTNQGSTPATTQVSPSSQNMSTVSAPITSTQILSTFPQ 693

  Fly   594 STTT----TSTSGPTTTTPRSTTT-----------TSTSGPTTTTPRSTTTT-----STSGPTTT 638
            |..|    ||::..|||||..||:           |.||...|.:|..|||:     |:|.|:||
Mouse   694 SQHTGSKGTSSNPQTTTTPVVTTSNPSATSRDQIQTETSSQRTISPGETTTSYASIMSSSAPSTT 758

  Fly   639 TPRSTTTTSTSGPTTTTPRSTTTTSTSG--PTTT--TPRSTTTTSTSGPTTTT------PRSTTT 693
              ...||||::..|:...|.|....|.|  |.||  :|.|...::.|.|.|:|      |:|..|
Mouse   759 --HMLTTTSSTQSTSVDTRHTIAVRTQGSTPATTQVSPSSQNMSTVSTPITSTQILSTLPQSQHT 821

  Fly   694 ----TSTSGPTTTTPRSTTT-----------TSTSGPTTTTPRSTTTT-----STSGPTTTTPRS 738
                ||::..|||:|..||:           |.||...|.:|..|||:     ::|.|:||...|
Mouse   822 GSKGTSSNPQTTTSPVVTTSTPSGTSGDQIQTETSSQRTISPGKTTTSHALNINSSAPSTTHMLS 886

  Fly   739 TT--TTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTT------TTPRSTTT----TS 791
            ||  |.||||.|..|....|..||...|..:|.|...::.|.|.|      |.|:|..|    ||
Mouse   887 TTSSTQSTSGDTRHTTAGRTQGSTPATTQVSPSSQNMSTVSAPITSIQMLSTLPQSQHTESKSTS 951

  Fly   792 TSGPTTTTPRSTTT-----------TSTSGPTTTTPRSTTTT-----STSGPTTTTPRSTTTTST 840
            |:..|||||..||:           |.||...|.:|..|||:     |:|.|:||...|||:::.
Mouse   952 TNPQTTTTPEVTTSNPSATSHDQIETETSSQRTISPGETTTSYAPIMSSSAPSTTHMLSTTSSTQ 1016

  Fly   841 SGPTTTTPRSTTTTSTSG--PTTT--TPRSTTTTSTSGPTTTT------PRSTTT----TSTSGP 891
            |  |:...|:|||.:|.|  |.||  :|.|...::.|.|.|:|      |:|..|    ||:|..
Mouse  1017 S--TSVDTRNTTTLTTQGSTPATTQVSPSSKNMSTVSTPITSTHKLSTLPQSQHTGSNGTSSSSS 1079

  Fly   892 TTTTPRS-----TTTTSTSGPTTTTPRSTT-----------------TTSTSCPTTTTPRSTT-- 932
            |..|.||     .:|.||  |.|||.:.:|                 ||:|...||:||.:||  
Mouse  1080 TPATHRSHLHPNMSTVST--PITTTHKLSTLSQSQHTGSKGTSSNPQTTTTPVMTTSTPSATTHD 1142

  Fly   933 --TTCTSGPTTTTPRSTTTT-----CTSCPTTTTPRST--TTTCTSCPTTTTPRSTTTTCTSGPT 988
              .|.||...|.:...|||:     .:|.|:||...||  :|..||..|..|...||...|...|
Mouse  1143 QIQTETSSQRTISHGETTTSYAPIMSSSAPSTTHMLSTASSTQITSVDTRHTTAITTQGSTPATT 1207

  Fly   989 TTTPRSTTKTSTCAPTT------TTPRSTTT----TSTSRPTTTTPRSTTT-----------TTT 1032
            ..:|.|...::..||.|      |.|:|..|    |||:..|||||..||:           |.|
Mouse  1208 QVSPSSQNMSTVSAPITSIQILSTLPQSQHTGSKGTSTNPQTTTTPEVTTSTPSATSRDQIQTET 1272

  Fly  1033 SRPTTTTPRSTTTP-----STSRPTTTTPRSTT--TTSTSRPTTTTPRSTTKTSTCAPTTTTPRS 1090
            |...|.:|..|||.     |:|.|:||...|||  |.|||..|..|....|:.||.|.|..:|.|
Mouse  1273 SSQRTISPGETTTSHAPIMSSSAPSTTHMLSTTSSTQSTSVDTRHTTAGRTQGSTPATTQVSPSS 1337

  Fly  1091 TTTTTTSR-------PTTTTPRSTTTTTTS-----RPTTTTPRSTTTPCT-------------SR 1130
            ...||||.       |:||...|||::|.|     |.|||.....:||.|             |.
Mouse  1338 QNMTTTSHALMSSSAPSTTHMLSTTSSTQSTSVDTRHTTTVTTQGSTPATTQVLPSSQNMSTVSA 1402

  Fly  1131 PTTTTPRSTTTT----TTSRPTTTTPRSTT-TPCPTTTPSA----------------SPTRTTTT 1174
            |.|:|...:|..    |.|:.|:|.|::|| ....|:||||                ||..|||:
Mouse  1403 PITSTQILSTLPQSQHTGSKGTSTNPQTTTNAEVTTSTPSATSHDQIETETSSQRTISPGETTTS 1467

  Fly  1175 RRP 1177
            ..|
Mouse  1468 HAP 1470

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sgs1NP_523475.3 None
Muc4NP_536705.3 repeat domain 78..2178 468/1421 (33%)
NIDO 2458..2615 CDD:214712
AMOP 2614..2726 CDD:128962
VWD 2730..2910 CDD:214566
EGF_CA 3385..3421 CDD:238011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126579
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.