DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sgs1 and MUC17

Sequence 1:NP_523475.3 Gene:Sgs1 FlyBaseID:FBgn0003372 Length:1286 Species:Drosophila melanogaster
Sequence 2:NP_001035194.1 Gene:MUC17 HGNCID:16800 Length:4493 Species:Homo sapiens

Alignment Length:1471 Identity:463/1472 (31%)
Similarity:668/1472 (45%) Gaps:353/1472 (24%)


  Fly    51 PVQPCDTDSNPTTTKPRQKTKRPKSTRRTTKRTKRPRRKTTKWTTKRATKRTTKRTTRRRPTTPK 115
            ||......|:..||........|..:..:|..|..|...|...:::.:|..||...|    :||.
Human  1956 PVTTYSQASSSPTTADGTSMPTPAYSEGSTPLTSMPLSTTLVVSSEASTLSTTPVDT----STPA 2016

  Fly   116 TPDT--TDSPITTTGAE---CTCSDRTT---------------ASSTDSTT---DRTTVTNTDWT 157
            |..|  :.||.|..|..   .|.|:|||               ..:|.|||   .:|.|||:...
Human  2017 TTSTEGSSSPTTAGGTSIQTSTPSERTTPLAGMPVSTTLVVSSEGNTLSTTPVDSKTQVTNSTEA 2081

  Fly   158 -------------------TPLCTDTPPCT---CSEESSTAIPSSPCIDTSTVIPTSPCTQETTT 200
                               :||.|..|..|   .|.|:|| :.::| :|:::.:.||  |:.:::
Human  2082 SSSATAEGSSMTISAPSEGSPLLTSIPLSTTPVASPEAST-LSTTP-VDSNSPVITS--TEVSSS 2142

  Fly   201 PTPT------CSTQGTQTTPCTCAQTTTT--------PRSTTTTSTSRPTTTTPRSTTTTTTSRP 251
            |.||      .||...:.||.|....:||        ..|||...||.|.|.:..:.::.|||..
Human  2143 PIPTEGTSMQTSTYSDRRTPLTSMPVSTTVVASSAISTLSTTPVDTSTPVTNSTEARSSPTTSEG 2207

  Fly   252 T---TTTPRSTTTTTTRRPTTTTPRCTTTTSTCAPT---TTTPRSTTTTTTSRPTT--------- 301
            |   |:||...:|..|..|.:|.|..|:..||.:.|   |:||.:|:|..||.|||         
Human  2208 TSMPTSTPSEGSTPFTSMPVSTMPVVTSEASTLSATPVDTSTPVTTSTEATSSPTTAEGTSIPTS 2272

  Fly   302 -----TTPRCT-------------TTTSTCSPTRTTPRSTTTTSTSRPT----TTTPRCTT---- 340
                 |||..:             :|.||......||.:|:|.::|.|.    |:.|..|:    
Human  2273 TLSEGTTPLTSIPVSHTLVANSEVSTLSTTPVDSNTPFTTSTEASSPPPTAEGTSMPTSTSSEGN 2337

  Fly   341 TPSTSRPTTTTPRSTTKTSTCAPT---TTTP---------RPTTTPSTSRPTTTTPRSTTTTSTS 393
            ||.|..|.:||..::.:|||.:.|   |:||         .|||...||.||:|....:|.. ||
Human  2338 TPLTRMPVSTTMVASFETSTLSTTPADTSTPVTTYSQAGSSPTTADDTSMPTSTYSEGSTPL-TS 2401

  Fly   394 RPTTTTPRSTTTTTTRRPT---TTTPRSTTTTSTSRPTT-------TTPRST-TTTTTSRPTTTT 447
            .|.:|.|..::..:|...|   |:||.:|:|.::|.|||       |:|.|. ||...|.|.:||
Human  2402 VPVSTMPVVSSEASTHSTTPVDTSTPVTTSTEASSSPTTAEGTSIPTSPPSEGTTPLASMPVSTT 2466

  Fly   448 PRSTTTTCTCSPT---TTTPRSTTTTSTSRPTT----TTPRST----TTTSTSGPTTTTP----- 496
            |..::...|.|.|   |:||.:|:|.::|.|||    ..|.||    :|..||.|.:|||     
Human  2467 PVVSSEAGTLSTTPVDTSTPMTTSTEASSSPTTAEDIVVPISTASEGSTLLTSIPVSTTPVASPE 2531

  Fly   497 ---RSTTTTTTSGPTTTTPRSTTTTCTCSPTTTTPRST----TTPSTSRPTTTTPRSTTTTCTCS 554
               .|||...::.|..|: ...:::.|.:..|:.|.||    :||..|.|.:|.|.:::...|.|
Human  2532 ASTLSTTPVDSNSPVVTS-TEISSSATSAEGTSMPTSTYSEGSTPLRSMPVSTKPLASSEASTLS 2595

  Fly   555 PT---TTTPRSTTTTSTSRPTT--------TTPRSTTTTTTSRPTTTTPRSTTTTSTSGPTTTTP 608
            .|   |:.|.:|:|.::|.|||        :||...:|:.||...:|.|.:::..||...|....
Human  2596 TTPVDTSIPVTTSTETSSSPTTAKDTSMPISTPSEVSTSLTSILVSTMPVASSEASTLSTTPVDT 2660

  Fly   609 RS--TTTTSTSGPTTTTPRSTTTTSTSG----PTTTTPRSTT--------TTSTSGPTTTTPRST 659
            |:  ||:|.||...||...|:..|||.|    |.|....|||        |.||:...|:||.:|
Human  2661 RTLVTTSTGTSSSPTTAEGSSMPTSTPGERSTPLTNILVSTTLLANSEASTLSTTPVDTSTPVTT 2725

  Fly   660 TTTSTSGPTT---TTPRSTTTTSTSGPTTTTPRST--------TTTSTSGPTTTTPRSTTTTSTS 713
            :..::|.|||   |:.|.:|.:..|.|.|:...||        :|.||:...|:.|.:|:|.::|
Human  2726 SAEASSSPTTAEGTSMRISTPSDGSTPLTSILVSTLPVASSEASTVSTTAVDTSIPVTTSTEASS 2790

  Fly   714 GPT--------TTTPRSTTTTSTSGPTTTTPRSTT---TTSTSGPTTTTPRSTTTTSTSGPTT-- 765
            .||        |:||..|:|..||.|...||.:::   |.||:...|:||.:|:|.::|.|||  
Human  2791 SPTTAEVTSMPTSTPSETSTPLTSMPVNHTPVASSEAGTLSTTPVDTSTPVTTSTKASSSPTTAE 2855

  Fly   766 --TTPRST----TTTSTSGPTTTTPRSTTTTSTSGPT---TTTPRSTTTTSTSGPTT-------- 813
              ..|.||    :|..||.|.:|||.:::..||...|   |:.|.:|:|..:|.|||        
Human  2856 GIVVPISTASEGSTLLTSIPVSTTPVASSEASTLSTTPVDTSIPVTTSTEGSSSPTTAEGTSMPI 2920

  Fly   814 TTPRSTTTTSTSGPTTTTP---RSTTTTSTSGPTTTTPRSTTTTSTSGPTT--------TTPRST 867
            :||...:|..||...:|.|   ...:|.||:...|.||.:|:..::|.|||        :||...
Human  2921 STPSEVSTPLTSILVSTVPVAGSEASTLSTTPVDTRTPVTTSAEASSSPTTAEGTSMPISTPGER 2985

  Fly   868 TTTSTSGPTTTTPRSTTTTSTSGPT---TTTPRSTTTTSTSGPTT--------TTPRSTTTTSTS 921
            .|..||...:|.|.:::..||...|   |:||.:|:|.::|.|||        :||...:|..||
Human  2986 RTPLTSMSVSTMPVASSEASTLSRTPADTSTPVTTSTEASSSPTTAEGTGIPISTPSEGSTPLTS 3050

  Fly   922 CPTTTTPRS-------------------TTTTCTSGPT----TTTPRST----TTTCTSCPTTTT 959
            .|.:|||.:                   |:|..:|.||    |:.|.||    :|..|..|.:||
Human  3051 IPVSTTPVAIPEASTLSTTPVDSNSPVVTSTEVSSSPTPAEGTSMPISTYSEGSTPLTGVPVSTT 3115

  Fly   960 P--RSTTTTCTSCPT-TTTPRSTTTTCTSGPTT---TTPRSTTKTSTCAPTTTTPRST------- 1011
            |  .|..:|.::.|. |:||.:|:|...|.|||   |:..::|.:....|.|..|.||       
Human  3116 PVTSSAISTLSTTPVDTSTPVTTSTEAHSSPTTSEGTSMPTSTPSEGSTPLTYMPVSTMLVVSSE 3180

  Fly  1012 ------TTTSTSRPTTTTPRSTTTTT---TSRPTTTTPRSTTTPSTSRPTTTTP--------RST 1059
                  |...||.|.||:..:|::||   ||.| |:||....||.||.|.:.||        .||
Human  3181 DSTLSATPVDTSTPVTTSTEATSSTTAEGTSIP-TSTPSEGMTPLTSVPVSNTPVASSEASILST 3244

  Fly  1060 TTTSTSRPTTTTPRSTTKTSTCAPT---TTTPRSTTTTTTSRPTTTTPRSTTTTTTSRPTT--TT 1119
            |...::.|.||    :|:.|:..||   |:.|.| |.:..|.|.|:.|.||||..:|..:|  ||
Human  3245 TPVDSNTPLTT----STEASSSPPTAEGTSMPTS-TPSEGSTPLTSMPVSTTTVASSETSTLSTT 3304

  Fly  1120 PRSTTTPC---------------TSRPTTT-----TPR-----STTTTTTSRPTT--TTPRSTTT 1157
            |..|:||.               ||.||:|     ||.     |||...:|..:|  |||..|:|
Human  3305 PADTSTPVTTYSQASSSPPIADGTSMPTSTYSEGSTPLTNMSFSTTPVVSSEASTLSTTPVDTST 3369

  Fly  1158 PCPTTT--------------PSASPTRTTTTRRPCPCHPQP 1184
            |..|:|              |::||:..||.....|....|
Human  3370 PVTTSTEASLSPTTAEGTSIPTSSPSEGTTPLASMPVSTTP 3410

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sgs1NP_523475.3 None
MUC17NP_001035194.1 SEA 4190..4276 CDD:279699
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126579
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.